Cmc02g0054371 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCCTATCGGACGTGGTCAGCGAGCATTAATAATTGGGGATAGGCAAATCGATAAAACTGTAGTAGCCACAGATACGATTCTCAATCAACAAAGGCAAAATATAATATGTGTTTATGTAGCTATTGGTAAAAAAGCATCTGTGGCTCAAGTAGTGACTACTTTACAGGAAAGGGGTGCAATGGAATACACTATTATAGTAGCCGAAATGGCAGATTCTCCGGCTACATTATAA ATGATTCCTATCGGACGTGGTCAGCGAGCATTAATAATTGGGGATAGGCAAATCGATAAAACTGTAGTAGCCACAGATACGATTCTCAATCAACAAAGGCAAAATATAATATGTGTTTATGTAGCTATTGGTAAAAAAGCATCTGTGGCTCAAGTAGTGACTACTTTACAGGAAAGGGGTGCAATGGAATACACTATTATAGTAGCCGAAATGGCAGATTCTCCGGCTACATTATAA ATGATTCCTATCGGACGTGGTCAGCGAGCATTAATAATTGGGGATAGGCAAATCGATAAAACTGTAGTAGCCACAGATACGATTCTCAATCAACAAAGGCAAAATATAATATGTGTTTATGTAGCTATTGGTAAAAAAGCATCTGTGGCTCAAGTAGTGACTACTTTACAGGAAAGGGGTGCAATGGAATACACTATTATAGTAGCCGAAATGGCAGATTCTCCGGCTACATTATAA MIPIGRGQRALIIGDRQIDKTVVATDTILNQQRQNIICVYVAIGKKASVAQVVTTLQERGAMEYTIIVAEMADSPATL Homology
BLAST of Cmc02g0054371 vs. NCBI nr
Match: YP_009505065.1 (ATP synthase CF1 alpha subunit [Cucurbita pepo] >ALO21744.1 AtpA [Cucurbita argyrosperma] >ALO21775.1 AtpA [Cucurbita argyrosperma var. palmeri] >ALO21877.1 AtpA [Cucurbita argyrosperma subsp. sororia] >ALO22589.1 AtpA [Cucurbita pepo subsp. fraterna] >ALO22636.1 AtpA [Cucurbita pepo subsp. ovifera] >ALO22733.1 AtpA [Cucurbita pepo var. ozarkana] >ALO22734.1 AtpA [Cucurbita pepo subsp. pepo] >ALO22815.1 AtpA [Cucurbita pepo var. texana]) HSP 1 Score: 131.0 bits (328), Expect = 4.6e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. NCBI nr
Match: XP_023554658.1 (uncharacterized protein LOC111811846 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 131.0 bits (328), Expect = 4.6e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. NCBI nr
Match: ALO21904.1 (AtpA [Cucurbita cordata] >ALO21987.1 AtpA [Cucurbita digitata]) HSP 1 Score: 131.0 bits (328), Expect = 4.6e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. NCBI nr
Match: ALO22114.1 (AtpA [Cucurbita ficifolia] >ALO22152.1 AtpA [Cucurbita foetidissima] >ALO22919.1 AtpA [Cucurbita pedatifolia] >QWV60825.1 ATP synthase CF1 alpha subunit [Cucurbita ficifolia] >QZL38756.1 ATP synthase CF1 alpha subunit [Cucurbita ficifolia]) HSP 1 Score: 131.0 bits (328), Expect = 4.6e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. NCBI nr
Match: YP_009447520.1 (ATP synthase CF1 alpha subunit [Cucurbita moschata] >ALO22375.1 AtpA [Cucurbita moschata] >ATY69952.1 ATP synthase CF1 alpha subunit [Cucurbita moschata]) HSP 1 Score: 131.0 bits (328), Expect = 4.6e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy Swiss-Prot
Match: Q68S21 (ATP synthase subunit alpha, chloroplastic OS=Panax ginseng OX=4054 GN=atpA PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.3e-29 Identity = 69/79 (87.34%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy Swiss-Prot
Match: Q8S8Y3 (ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna OX=33113 GN=atpA PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.9e-29 Identity = 69/79 (87.34%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy Swiss-Prot
Match: B1NWD5 (ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta OX=3983 GN=atpA PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.9e-29 Identity = 69/79 (87.34%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy Swiss-Prot
Match: Q09X32 (ATP synthase subunit alpha, chloroplastic OS=Morus indica OX=248361 GN=atpA PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.9e-29 Identity = 69/79 (87.34%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy Swiss-Prot
Match: Q3C1H4 (ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=atpA PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.9e-29 Identity = 69/79 (87.34%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy TrEMBL
Match: A0A1D0C1T5 (ATP synthase subunit alpha, chloroplastic OS=Acacia merrallii OX=1378388 GN=atpA PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.2e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy TrEMBL
Match: A0A0S2IG79 (ATP synthase subunit alpha OS=Cucurbita moschata OX=3662 GN=atpA PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.2e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy TrEMBL
Match: A0A0S2IE22 (ATP synthase subunit alpha OS=Cucurbita argyrosperma OX=34294 GN=atpA PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.2e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy TrEMBL
Match: A0A2H4T1V9 (ATP synthase subunit alpha, chloroplastic OS=Cucurbita maxima OX=3661 GN=atpA PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.2e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. ExPASy TrEMBL
Match: A0A0S2IHI4 (ATP synthase subunit alpha OS=Cucurbita pepo var. texana OX=37651 GN=atpA PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.2e-27 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of Cmc02g0054371 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 126.7 bits (317), Expect = 8.1e-30 Identity = 68/79 (86.08%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of Cmc02g0054371 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 84.7 bits (208), Expect = 3.5e-17 Identity = 46/88 (52.27%), Postives = 62/88 (70.45%), Query Frame = 0
BLAST of Cmc02g0054371 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 82.0 bits (201), Expect = 2.3e-16 Identity = 45/88 (51.14%), Postives = 61/88 (69.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|