Cmc02g0050531 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAAGGGTACGACGACGATGGCGATCTCATTGTTTGCTGGGTTTGTGTGTTTTTTCCTGCCTCTTCTCGTTTCCAGTAGCTTGTGATTGTATTTTCTTTTTGCTATTATGTTTTTTATGAAATTTGAAAATTTGGTGTTATTTGGCTCAGTTATCAAGCAAGAGGAAGGTGACGATTCAGAATTTTAAGGGGAAGACTCTGGTTTCGATTATGGAGTTTTATAGAAATTAG ATGAAGAAAGGGTACGACGACGATGGCGATCTCATTGTTTGCTGGTTATCAAGCAAGAGGAAGGTGACGATTCAGAATTTTAAGGGGAAGACTCTGGTTTCGATTATGGAGTTTTATAGAAATTAG ATGAAGAAAGGGTACGACGACGATGGCGATCTCATTGTTTGCTGGTTATCAAGCAAGAGGAAGGTGACGATTCAGAATTTTAAGGGGAAGACTCTGGTTTCGATTATGGAGTTTTATAGAAATTAG MKKGYDDDGDLIVCWLSSKRKVTIQNFKGKTLVSIMEFYRN Homology
BLAST of Cmc02g0050531 vs. NCBI nr
Match: KAA0046625.1 (RNA polymerase II transcriptional coactivator KELP [Cucumis melo var. makuwa]) HSP 1 Score: 75.5 bits (184), Expect = 1.2e-10 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of Cmc02g0050531 vs. NCBI nr
Match: XP_008451928.1 (PREDICTED: RNA polymerase II transcriptional coactivator KELP [Cucumis melo] >KAA0044928.1 RNA polymerase II transcriptional coactivator KELP [Cucumis melo var. makuwa] >TYK16542.1 RNA polymerase II transcriptional coactivator KELP [Cucumis melo var. makuwa]) HSP 1 Score: 75.1 bits (183), Expect = 1.6e-10 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. NCBI nr
Match: XP_022931551.1 (RNA polymerase II transcriptional coactivator KELP-like [Cucurbita moschata] >XP_023551821.1 RNA polymerase II transcriptional coactivator KELP-like [Cucurbita pepo subsp. pepo] >KAG6577134.1 RNA polymerase II transcriptional coactivator KELP, partial [Cucurbita argyrosperma subsp. sororia] >KAG7015130.1 RNA polymerase II transcriptional coactivator KELP [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 75.1 bits (183), Expect = 1.6e-10 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. NCBI nr
Match: XP_022985429.1 (RNA polymerase II transcriptional coactivator KELP-like isoform X3 [Cucurbita maxima]) HSP 1 Score: 75.1 bits (183), Expect = 1.6e-10 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. NCBI nr
Match: XP_038878439.1 (RNA polymerase II transcriptional coactivator KELP-like [Benincasa hispida]) HSP 1 Score: 75.1 bits (183), Expect = 1.6e-10 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. ExPASy Swiss-Prot
Match: O65155 (RNA polymerase II transcriptional coactivator KELP OS=Arabidopsis thaliana OX=3702 GN=KELP PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 2.4e-09 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0
BLAST of Cmc02g0050531 vs. ExPASy TrEMBL
Match: A0A5A7TZ23 (RNA polymerase II transcriptional coactivator KELP OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold114G001770 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 5.8e-11 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of Cmc02g0050531 vs. ExPASy TrEMBL
Match: A0A6J1J851 (RNA polymerase II transcriptional coactivator KELP-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111483435 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 7.6e-11 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. ExPASy TrEMBL
Match: A0A5A7TPV6 (RNA polymerase II transcriptional coactivator KELP OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G003580 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 7.6e-11 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. ExPASy TrEMBL
Match: A0A6J1JD91 (RNA polymerase II transcriptional coactivator KELP-like isoform X3 OS=Cucurbita maxima OX=3661 GN=LOC111483435 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 7.6e-11 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. ExPASy TrEMBL
Match: A0A6J1JDK7 (RNA polymerase II transcriptional coactivator KELP-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111483435 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 7.6e-11 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cmc02g0050531 vs. TAIR 10
Match: AT4G10920.1 (transcriptional coactivator p15 (PC4) family protein (KELP) ) HSP 1 Score: 61.6 bits (148), Expect = 1.7e-10 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0
BLAST of Cmc02g0050531 vs. TAIR 10
Match: AT4G10920.2 (transcriptional coactivator p15 (PC4) family protein (KELP) ) HSP 1 Score: 61.6 bits (148), Expect = 1.7e-10 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|