Cmc02g0048201 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATGATGTGGACTGTGACCAATGGATCAAAGCCATGGACCTCGAAATGGAATCTATGTATTTCAATTCTGTCTGGACTCTAGTAGATCAACCAAATGATGTAAAACCTATTGGTTGTAAATGGATCTACAAGAGAAAACGAGACCAAGCTGGTAAAGTACAGACTTTCAAAGCTCGACTAGTGGCAAAAGGTTACACACAAAAGGAGGGAATAGATTATGAAGAAGTTTTCTCTTCTATTGCCATGATAAAGTCGATTAGAATACTTTTATCCATCGCCACTTTTTATGATTATGAAATTTGGCAGATGGATGTCAATACAACATTTTTGAATGGAAATCTTGAAGAGAGTATCTATATGGTCCAACCAGAGGGGTTTATACGGTCAAGAACAAAAGATTTGTAA ATGAATGATGTGGACTGTGACCAATGGATCAAAGCCATGGACCTCGAAATGGAATCTATGTATTTCAATTCTGTCTGGACTCTAGTAGATCAACCAAATGATGTAAAACCTATTGGTTGTAAATGGATCTACAAGAGAAAACGAGACCAAGCTGGTAAAGTACAGACTTTCAAAGCTCGACTAGTGGCAAAAGGTTACACACAAAAGGAGGGAATAGATTATGAAGAAGTTTTCTCTTCTATTGCCATGATAAAGTCGATTAGAATACTTTTATCCATCGCCACTTTTTATGATTATGAAATTTGGCAGATGGATGTCAATACAACATTTTTGAATGGAAATCTTGAAGAGAGTATCTATATGGTCCAACCAGAGGGGTTTATACGGTCAAGAACAAAAGATTTGTAA ATGAATGATGTGGACTGTGACCAATGGATCAAAGCCATGGACCTCGAAATGGAATCTATGTATTTCAATTCTGTCTGGACTCTAGTAGATCAACCAAATGATGTAAAACCTATTGGTTGTAAATGGATCTACAAGAGAAAACGAGACCAAGCTGGTAAAGTACAGACTTTCAAAGCTCGACTAGTGGCAAAAGGTTACACACAAAAGGAGGGAATAGATTATGAAGAAGTTTTCTCTTCTATTGCCATGATAAAGTCGATTAGAATACTTTTATCCATCGCCACTTTTTATGATTATGAAATTTGGCAGATGGATGTCAATACAACATTTTTGAATGGAAATCTTGAAGAGAGTATCTATATGGTCCAACCAGAGGGGTTTATACGGTCAAGAACAAAAGATTTGTAA MNDVDCDQWIKAMDLEMESMYFNSVWTLVDQPNDVKPIGCKWIYKRKRDQAGKVQTFKARLVAKGYTQKEGIDYEEVFSSIAMIKSIRILLSIATFYDYEIWQMDVNTTFLNGNLEESIYMVQPEGFIRSRTKDL Homology
BLAST of Cmc02g0048201 vs. NCBI nr
Match: KAA0050040.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 280.0 bits (715), Expect = 1.1e-71 Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 0
BLAST of Cmc02g0048201 vs. NCBI nr
Match: TYK02298.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 246.1 bits (627), Expect = 1.7e-61 Identity = 115/129 (89.15%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cmc02g0048201 vs. NCBI nr
Match: KAA0060572.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 246.1 bits (627), Expect = 1.7e-61 Identity = 115/129 (89.15%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cmc02g0048201 vs. NCBI nr
Match: KAA0037081.1 (gag/pol protein [Cucumis melo var. makuwa] >TYK06570.1 gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 245.7 bits (626), Expect = 2.2e-61 Identity = 116/129 (89.92%), Postives = 121/129 (93.80%), Query Frame = 0
BLAST of Cmc02g0048201 vs. NCBI nr
Match: KAA0051500.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 245.7 bits (626), Expect = 2.2e-61 Identity = 115/129 (89.15%), Postives = 122/129 (94.57%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.8e-29 Identity = 61/121 (50.41%), Postives = 86/121 (71.07%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.8e-24 Identity = 54/123 (43.90%), Postives = 75/123 (60.98%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 5.0e-24 Identity = 54/123 (43.90%), Postives = 75/123 (60.98%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 110.5 bits (275), Expect = 1.5e-23 Identity = 50/122 (40.98%), Postives = 77/122 (63.11%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy Swiss-Prot
Match: P92520 (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana OX=3702 GN=AtMg00820 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 4.0e-13 Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy TrEMBL
Match: A0A5A7U428 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold675G00160 PE=4 SV=1) HSP 1 Score: 280.0 bits (715), Expect = 5.1e-72 Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy TrEMBL
Match: A0A5D3BTJ6 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold18G001090 PE=4 SV=1) HSP 1 Score: 246.1 bits (627), Expect = 8.2e-62 Identity = 115/129 (89.15%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy TrEMBL
Match: A0A5A7UXJ0 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold22G004410 PE=4 SV=1) HSP 1 Score: 246.1 bits (627), Expect = 8.2e-62 Identity = 115/129 (89.15%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy TrEMBL
Match: A0A5D3C5F1 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold453G00320 PE=4 SV=1) HSP 1 Score: 245.7 bits (626), Expect = 1.1e-61 Identity = 116/129 (89.92%), Postives = 121/129 (93.80%), Query Frame = 0
BLAST of Cmc02g0048201 vs. ExPASy TrEMBL
Match: A0A5A7U8L5 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold174G00210 PE=4 SV=1) HSP 1 Score: 245.7 bits (626), Expect = 1.1e-61 Identity = 115/129 (89.15%), Postives = 122/129 (94.57%), Query Frame = 0
BLAST of Cmc02g0048201 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 125.6 bits (314), Expect = 3.1e-29 Identity = 54/119 (45.38%), Postives = 82/119 (68.91%), Query Frame = 0
BLAST of Cmc02g0048201 vs. TAIR 10
Match: ATMG00820.1 (Reverse transcriptase (RNA-dependent DNA polymerase) ) HSP 1 Score: 75.9 bits (185), Expect = 2.8e-14 Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|