Cmc02g0044761 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.GCTTGGAAAAGGGTTGAATAGAACGACAGCCACGTTAGTAGCGGGAGGTCTAGGATTTGTAGCTCATTACATTTCAAGTATTTGTGGAAAGATTGGACATCCCATATTGTTAGGGATCTTTATATCCATCATGAGTAAGTAATCTATATATATATGCAATCCTAATTTGTTTCAACATCAATTAGATTCAACAAATTAAACAAATGAAAAAGGTTTAATTTATTGTGTTGTGATTCAGGTGGAATAGCAACATATCTTCGATTCTTCCCCAAGTTGAAGGCGAAATATGATTATGGGCTTTTGATATTCATATTGACATTTGATATGGTGGCAGTGTCTGGTTATAGAGATGATGAGATCTTGAAATTGGCTTGGCATAGGCTTGCTAACATTCTCATGGGTGGCTTTATTGCTGTGGCTGTTTGTATCTTTGTTAGACCTGTTTGGGCTGGTGCTGATCTTCATCAATTGGTTTCTACCAATATTCAAAACCTTGGGACCTTCTTTGAAGGTGAATCTTCATCTTTAATTTAA GCTTGGAAAAGGGTTGAATAGAACGACAGCCACGTTAGTAGCGGGAGGTCTAGGATTTGTAGCTCATTACATTTCAAGTATTTGTGGAAAGATTGGACATCCCATATTGTTAGGGATCTTTATATCCATCATGAGTGGAATAGCAACATATCTTCGATTCTTCCCCAAGTTGAAGGCGAAATATGATTATGGGCTTTTGATATTCATATTGACATTTGATATGGTGGCAGTGTCTGGTTATAGAGATGATGAGATCTTGAAATTGGCTTGGCATAGGCTTGCTAACATTCTCATGGGTGGCTTTATTGCTGTGGCTGTTTGTATCTTTGTTAGACCTGTTTGGGCTGGTGCTGATCTTCATCAATTGGTTTCTACCAATATTCAAAACCTTGGGACCTTCTTTGAAGGTGAATCTTCATCTTTAATTTAA ATGAGTGGAATAGCAACATATCTTCGATTCTTCCCCAAGTTGAAGGCGAAATATGATTATGGGCTTTTGATATTCATATTGACATTTGATATGGTGGCAGTGTCTGGTTATAGAGATGATGAGATCTTGAAATTGGCTTGGCATAGGCTTGCTAACATTCTCATGGGTGGCTTTATTGCTGTGGCTGTTTGTATCTTTGTTAGACCTGTTTGGGCTGGTGCTGATCTTCATCAATTGGTTTCTACCAATATTCAAAACCTTGGGACCTTCTTTGAAGGTGAATCTTCATCTTTAATTTAA MSGIATYLRFFPKLKAKYDYGLLIFILTFDMVAVSGYRDDEILKLAWHRLANILMGGFIAVAVCIFVRPVWAGADLHQLVSTNIQNLGTFFEGESSSLI Homology
BLAST of Cmc02g0044761 vs. NCBI nr
Match: KGN66580.1 (hypothetical protein Csa_007358 [Cucumis sativus]) HSP 1 Score: 191.8 bits (486), Expect = 2.8e-45 Identity = 93/99 (93.94%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cmc02g0044761 vs. NCBI nr
Match: KAA0055916.1 (aluminum-activated malate transporter 2 [Cucumis melo var. makuwa] >TYK28119.1 aluminum-activated malate transporter 2 [Cucumis melo var. makuwa]) HSP 1 Score: 189.1 bits (479), Expect = 1.8e-44 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Cmc02g0044761 vs. NCBI nr
Match: XP_004139137.1 (aluminum-activated malate transporter 2 [Cucumis sativus]) HSP 1 Score: 183.3 bits (464), Expect = 9.9e-43 Identity = 88/93 (94.62%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Cmc02g0044761 vs. NCBI nr
Match: XP_038880423.1 (aluminum-activated malate transporter 2-like [Benincasa hispida]) HSP 1 Score: 180.3 bits (456), Expect = 8.4e-42 Identity = 86/93 (92.47%), Postives = 91/93 (97.85%), Query Frame = 0
BLAST of Cmc02g0044761 vs. NCBI nr
Match: XP_023530353.1 (aluminum-activated malate transporter 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 168.7 bits (426), Expect = 2.5e-38 Identity = 79/93 (84.95%), Postives = 88/93 (94.62%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy Swiss-Prot
Match: Q9SRM9 (Aluminum-activated malate transporter 8 OS=Arabidopsis thaliana OX=3702 GN=ALMT8 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.5e-25 Identity = 52/93 (55.91%), Postives = 69/93 (74.19%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy Swiss-Prot
Match: Q9SJE8 (Aluminum-activated malate transporter 2 OS=Arabidopsis thaliana OX=3702 GN=ALMT2 PE=2 SV=2) HSP 1 Score: 113.2 bits (282), Expect = 1.7e-24 Identity = 49/92 (53.26%), Postives = 72/92 (78.26%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy Swiss-Prot
Match: Q9XIN1 (Aluminum-activated malate transporter 7 OS=Arabidopsis thaliana OX=3702 GN=ALMT7 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.4e-23 Identity = 45/94 (47.87%), Postives = 72/94 (76.60%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy Swiss-Prot
Match: Q76LB1 (Aluminum-activated malate transporter 1 OS=Triticum aestivum OX=4565 GN=ALMT1 PE=1 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.9e-22 Identity = 48/93 (51.61%), Postives = 66/93 (70.97%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy Swiss-Prot
Match: Q9SJE9 (Aluminum-activated malate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ALMT1 PE=1 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 7.7e-22 Identity = 44/91 (48.35%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy TrEMBL
Match: A0A0A0LXK8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G630840 PE=3 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 1.3e-45 Identity = 93/99 (93.94%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy TrEMBL
Match: A0A5D3DXG5 (Aluminum-activated malate transporter 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold289G00250 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 8.7e-45 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy TrEMBL
Match: A0A6J1KQZ3 (aluminum-activated malate transporter 2-like OS=Cucurbita maxima OX=3661 GN=LOC111496849 PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.6e-38 Identity = 78/93 (83.87%), Postives = 87/93 (93.55%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy TrEMBL
Match: A0A6J1DGA3 (aluminum-activated malate transporter 2-like OS=Momordica charantia OX=3673 GN=LOC111020785 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 6.3e-35 Identity = 70/93 (75.27%), Postives = 82/93 (88.17%), Query Frame = 0
BLAST of Cmc02g0044761 vs. ExPASy TrEMBL
Match: A0A6I9U8Q6 (aluminum-activated malate transporter 2 OS=Sesamum indicum OX=4182 GN=LOC105171011 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.6e-28 Identity = 57/93 (61.29%), Postives = 77/93 (82.80%), Query Frame = 0
BLAST of Cmc02g0044761 vs. TAIR 10
Match: AT3G11680.1 (Aluminium activated malate transporter family protein ) HSP 1 Score: 116.7 bits (291), Expect = 1.1e-26 Identity = 52/93 (55.91%), Postives = 69/93 (74.19%), Query Frame = 0
BLAST of Cmc02g0044761 vs. TAIR 10
Match: AT1G08440.1 (Aluminium activated malate transporter family protein ) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-25 Identity = 49/92 (53.26%), Postives = 72/92 (78.26%), Query Frame = 0
BLAST of Cmc02g0044761 vs. TAIR 10
Match: AT2G27240.1 (Aluminium activated malate transporter family protein ) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-24 Identity = 45/94 (47.87%), Postives = 72/94 (76.60%), Query Frame = 0
BLAST of Cmc02g0044761 vs. TAIR 10
Match: AT1G08430.1 (aluminum-activated malate transporter 1 ) HSP 1 Score: 104.4 bits (259), Expect = 5.5e-23 Identity = 44/91 (48.35%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of Cmc02g0044761 vs. TAIR 10
Match: AT4G00910.1 (Aluminium activated malate transporter family protein ) HSP 1 Score: 94.4 bits (233), Expect = 5.6e-20 Identity = 40/89 (44.94%), Postives = 62/89 (69.66%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|