Cmc02g0042341 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTTATTTTTAATAGATGAGGATCCTAACACTTATCAAGAGGCCTTAAACTCTGTAGAGTCAAGTATGTGGAATGAGGCTATTAAGAGTGAACTGGATTCAGTGACCATGAATCAAACATGGGAATTAGTAGACCTTCCCAAAGGAAGTAAGCCAATTAAGTGTAAGTGGATCTTCAAAAGAAAAACAAGACCAAATGGGTCAATAGCAATGTATACTCAAAAGCAATGTATTGATTACTTTGACACATATTCCCCTGTAACTAAGATAACCATAATTAGGGTCTTGATTGCACTAGCTTCTATACAGAGTCTTCTTATTCACCAGATGGATGTAAAAACTGCTTTTCTAAATGGTGATTTAGAAGAAGAAATTTATAACACAACCAGAAGGGTTCAAAATTCCTGGCCAAGAAAATAA ATGAATTTATTTTTAATAGATGAGGATCCTAACACTTATCAAGAGGCCTTAAACTCTGTAGAGTCAAGTATGTGGAATGAGGCTATTAAGAGTGAACTGGATTCAGTGACCATGAATCAAACATGGGAATTAGTAGACCTTCCCAAAGGAAGTAAGCCAATTAAGTGTAAGTGGATCTTCAAAAGAAAAACAAGACCAAATGGGTCAATAGCAATGTATACTCAAAAGCAATGTATTGATTACTTTGACACATATTCCCCTGTAACTAAGATAACCATAATTAGGGTCTTGATTGCACTAGCTTCTATACAGAGTCTTCTTATTCACCAGATGGATGTAAAAACTGCTTTTCTAAATGGTGATTTAGAAGAAGAAATTTATAACACAACCAGAAGGGTTCAAAATTCCTGGCCAAGAAAATAA ATGAATTTATTTTTAATAGATGAGGATCCTAACACTTATCAAGAGGCCTTAAACTCTGTAGAGTCAAGTATGTGGAATGAGGCTATTAAGAGTGAACTGGATTCAGTGACCATGAATCAAACATGGGAATTAGTAGACCTTCCCAAAGGAAGTAAGCCAATTAAGTGTAAGTGGATCTTCAAAAGAAAAACAAGACCAAATGGGTCAATAGCAATGTATACTCAAAAGCAATGTATTGATTACTTTGACACATATTCCCCTGTAACTAAGATAACCATAATTAGGGTCTTGATTGCACTAGCTTCTATACAGAGTCTTCTTATTCACCAGATGGATGTAAAAACTGCTTTTCTAAATGGTGATTTAGAAGAAGAAATTTATAACACAACCAGAAGGGTTCAAAATTCCTGGCCAAGAAAATAA MNLFLIDEDPNTYQEALNSVESSMWNEAIKSELDSVTMNQTWELVDLPKGSKPIKCKWIFKRKTRPNGSIAMYTQKQCIDYFDTYSPVTKITIIRVLIALASIQSLLIHQMDVKTAFLNGDLEEEIYNTTRRVQNSWPRK Homology
BLAST of Cmc02g0042341 vs. NCBI nr
Match: TYK06518.1 (ty1-copia retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 208.0 bits (528), Expect = 5.3e-50 Identity = 105/137 (76.64%), Postives = 114/137 (83.21%), Query Frame = 0
BLAST of Cmc02g0042341 vs. NCBI nr
Match: KAD6453934.1 (hypothetical protein E3N88_08640 [Mikania micrantha]) HSP 1 Score: 179.5 bits (454), Expect = 2.0e-41 Identity = 86/136 (63.24%), Postives = 108/136 (79.41%), Query Frame = 0
BLAST of Cmc02g0042341 vs. NCBI nr
Match: OMO89770.1 (Integrase, catalytic core [Corchorus capsularis]) HSP 1 Score: 170.6 bits (431), Expect = 9.4e-39 Identity = 85/139 (61.15%), Postives = 105/139 (75.54%), Query Frame = 0
BLAST of Cmc02g0042341 vs. NCBI nr
Match: PNX71449.1 (retrotransposon-related protein, partial [Trifolium pratense]) HSP 1 Score: 169.5 bits (428), Expect = 2.1e-38 Identity = 82/134 (61.19%), Postives = 102/134 (76.12%), Query Frame = 0
BLAST of Cmc02g0042341 vs. NCBI nr
Match: KAG9440057.1 (hypothetical protein H6P81_020222 [Aristolochia fimbriata]) HSP 1 Score: 167.2 bits (422), Expect = 1.0e-37 Identity = 82/133 (61.65%), Postives = 102/133 (76.69%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.6e-23 Identity = 55/130 (42.31%), Postives = 86/130 (66.15%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 94.7 bits (234), Expect = 8.6e-19 Identity = 49/132 (37.12%), Postives = 76/132 (57.58%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 4.4e-15 Identity = 47/131 (35.88%), Postives = 75/131 (57.25%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.9e-14 Identity = 45/131 (34.35%), Postives = 73/131 (55.73%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy Swiss-Prot
Match: P92520 (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana OX=3702 GN=AtMg00820 PE=4 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.2e-07 Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy TrEMBL
Match: A0A5D3C5T2 (Ty1-copia retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold70G00500 PE=4 SV=1) HSP 1 Score: 208.0 bits (528), Expect = 2.6e-50 Identity = 105/137 (76.64%), Postives = 114/137 (83.21%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy TrEMBL
Match: A0A5N6PGV2 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_08640 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 9.8e-42 Identity = 86/136 (63.24%), Postives = 108/136 (79.41%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy TrEMBL
Match: A0A2N9HRF5 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS42205 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 4.9e-41 Identity = 84/133 (63.16%), Postives = 105/133 (78.95%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy TrEMBL
Match: A0A2N9HA40 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS36667 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 4.9e-41 Identity = 84/133 (63.16%), Postives = 105/133 (78.95%), Query Frame = 0
BLAST of Cmc02g0042341 vs. ExPASy TrEMBL
Match: A0A2N9EWQ0 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS7157 PE=4 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 2.4e-40 Identity = 83/133 (62.41%), Postives = 104/133 (78.20%), Query Frame = 0
BLAST of Cmc02g0042341 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 108.2 bits (269), Expect = 5.3e-24 Identity = 51/129 (39.53%), Postives = 83/129 (64.34%), Query Frame = 0
BLAST of Cmc02g0042341 vs. TAIR 10
Match: ATMG00820.1 (Reverse transcriptase (RNA-dependent DNA polymerase) ) HSP 1 Score: 57.8 bits (138), Expect = 8.3e-09 Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|