
Cmc01g0015531 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGTCAAAATGACATTTTTAAATGGTGATTTAGATGAAGAAATCTACATGCAACAACCTAAAGGGTTTGTTTTCCTCGATCAAGAAAAGAAAGTTTGCAAATTAATTAGGTCTCTTTATGGACTAAAACAAGCACCAAAACAATGGCTTGAAAGATTTGACAGTGTAATGATGGCCAATGGGTTTAAAATCAATGAATGTGACAAATGTGTATATGTCAAAAACAATGAGAATGACCATGTCATTGTGTGCCTATATGTTGATGATATGCTAATTATTGGTAGCAATATCAACATTATTAAGACTACCAAACAAATGTTGGCCAATAAATTTAAGATGAAAGACATGGGTGTCGTAGATGTTATTCTAGATATTAAAATTTTTAAAACCCCATAA ATGGATGTCAAAATGACATTTTTAAATGGTGATTTAGATGAAGAAATCTACATGCAACAACCTAAAGGGTTTGTTTTCCTCGATCAAGAAAAGAAAGTTTGCAAATTAATTAGGTCTCTTTATGGACTAAAACAAGCACCAAAACAATGGCTTGAAAGATTTGACAGTGTAATGATGGCCAATGGGTTTAAAATCAATGAATGTGACAAATGTGTATATGTCAAAAACAATGAGAATGACCATGTCATTGTGTGCCTATATGTTGATGATATGCTAATTATTGGTAGCAATATCAACATTATTAAGACTACCAAACAAATGTTGGCCAATAAATTTAAGATGAAAGACATGGGTGTCGTAGATGTTATTCTAGATATTAAAATTTTTAAAACCCCATAA ATGGATGTCAAAATGACATTTTTAAATGGTGATTTAGATGAAGAAATCTACATGCAACAACCTAAAGGGTTTGTTTTCCTCGATCAAGAAAAGAAAGTTTGCAAATTAATTAGGTCTCTTTATGGACTAAAACAAGCACCAAAACAATGGCTTGAAAGATTTGACAGTGTAATGATGGCCAATGGGTTTAAAATCAATGAATGTGACAAATGTGTATATGTCAAAAACAATGAGAATGACCATGTCATTGTGTGCCTATATGTTGATGATATGCTAATTATTGGTAGCAATATCAACATTATTAAGACTACCAAACAAATGTTGGCCAATAAATTTAAGATGAAAGACATGGGTGTCGTAGATGTTATTCTAGATATTAAAATTTTTAAAACCCCATAA MDVKMTFLNGDLDEEIYMQQPKGFVFLDQEKKVCKLIRSLYGLKQAPKQWLERFDSVMMANGFKINECDKCVYVKNNENDHVIVCLYVDDMLIIGSNINIIKTTKQMLANKFKMKDMGVVDVILDIKIFKTP Homology
BLAST of Cmc01g0015531 vs. NCBI nr
Match: RVW42300.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 202.6 bits (514), Expect = 2.1e-48 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. NCBI nr
Match: RVW67960.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 201.1 bits (510), Expect = 6.1e-48 Identity = 94/131 (71.76%), Postives = 113/131 (86.26%), Query Frame = 0
BLAST of Cmc01g0015531 vs. NCBI nr
Match: CAN66626.1 (hypothetical protein VITISV_001861 [Vitis vinifera]) HSP 1 Score: 201.1 bits (510), Expect = 6.1e-48 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. NCBI nr
Match: RVW97088.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 197.6 bits (501), Expect = 6.8e-47 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. NCBI nr
Match: RVW82452.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 196.1 bits (497), Expect = 2.0e-46 Identity = 93/131 (70.99%), Postives = 113/131 (86.26%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-28 Identity = 65/131 (49.62%), Postives = 88/131 (67.18%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 95.9 bits (237), Expect = 3.6e-19 Identity = 51/130 (39.23%), Postives = 77/130 (59.23%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 9.0e-18 Identity = 46/132 (34.85%), Postives = 74/132 (56.06%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.4e-17 Identity = 45/132 (34.09%), Postives = 75/132 (56.82%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy Swiss-Prot
Match: P25600 (Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY5A PE=5 SV=2) HSP 1 Score: 88.6 bits (218), Expect = 5.8e-17 Identity = 47/131 (35.88%), Postives = 72/131 (54.96%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy TrEMBL
Match: A0A438E3U6 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_3747 PE=4 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 1.0e-48 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy TrEMBL
Match: A0A438G6X1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_1536 PE=4 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 3.0e-48 Identity = 94/131 (71.76%), Postives = 113/131 (86.26%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy TrEMBL
Match: A5AED7 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Vitis vinifera OX=29760 GN=VITISV_001861 PE=4 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 3.0e-48 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy TrEMBL
Match: A0A2N9FGP9 (Integrase catalytic domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS14225 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 8.6e-48 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. ExPASy TrEMBL
Match: A0A2N9GUH4 (Integrase catalytic domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS30816 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 8.6e-48 Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = 0
BLAST of Cmc01g0015531 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 89.4 bits (220), Expect = 2.4e-18 Identity = 47/135 (34.81%), Postives = 76/135 (56.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|