Cmc00g0001331 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TACTGTACTAATATGTGTAGGTCCCCGTAATTCGAGTGAGATTGTCATGGCGCAAAAGCAGATATGGTCCGGTATTCCCTTGTTCCCTGTATTGGTTATGTTCTTTATTTCTCGTCTAGCAGAAACTAATCGAGCTCCCTTTGATCTCCCAGAAGCGGAAGCTGAATCAGTTGCAGGCTATAATGTAGAATATGCGCGGGATGCGATCCTTAATAGTCCACTGTTGGCGGAAGCCAATGTCCCGGGGTCCCGGGGACTCATTCTGACTGAAACAAGGGGTGGGTCTTTACCAATTCGCGATTTCAGCCAAAAAAGGTGAG TACTGTACTAATATGTGTAGGTCCCCGTAATTCGAGTGAGATTGTCATGGCGCAAAAGCAGATATGGTCCGGTATTCCCTTGTTCCCTGTATTGGTTATGTTCTTTATTTCTCGTCTAGCAGAAACTAATCGAGCTCCCTTTGATCTCCCAGAAGCGGAAGCTGAATCAGTTGCAGGCTATAATGTAGAATATGCGCGGGATGCGATCCTTAATAGTCCACTGTTGGCGGAAGCCAATGTCCCGGGGTCCCGGGGACTCATTCTGACTGAAACAAGGGGTGGGTCTTTACCAATTCGCGATTTCAGCCAAAAAAGGTGAG ATGGCGCAAAAGCAGATATGGTCCGGTATTCCCTTGTTCCCTGTATTGGTTATGTTCTTTATTTCTCGTCTAGCAGAAACTAATCGAGCTCCCTTTGATCTCCCAGAAGCGGAAGCTGAATCAGTTGCAGGCTATAATGTAGAATATGCGCGGGATGCGATCCTTAATAGTCCACTGTTGGCGGAAGCCAATGTCCCGGGGTCCCGGGGACTCATTCTGACTGAAACAAGGGGTGGGTCTTTACCAATTCGCGATTTCAGCCAAAAAAGGTGA MAQKQIWSGIPLFPVLVMFFISRLAETNRAPFDLPEAEAESVAGYNVEYARDAILNSPLLAEANVPGSRGLILTETRGGSLPIRDFSQKR Homology
BLAST of Cmc00g0001331 vs. NCBI nr
Match: KAA0040733.1 (hypothetical protein E6C27_scaffold45541G00090 [Cucumis melo var. makuwa] >TYK09385.1 hypothetical protein E5676_scaffold77471G00010 [Cucumis melo var. makuwa]) HSP 1 Score: 181.0 bits (458), Expect = 4.5e-42 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Cmc00g0001331 vs. NCBI nr
Match: PKI40647.1 (hypothetical protein CRG98_038962 [Punica granatum]) HSP 1 Score: 168.3 bits (425), Expect = 3.0e-38 Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of Cmc00g0001331 vs. NCBI nr
Match: QGW48297.1 (hypothetical protein [Raphanus sativus] >QGW48519.1 hypothetical protein [Raphanus sativus]) HSP 1 Score: 167.9 bits (424), Expect = 3.9e-38 Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of Cmc00g0001331 vs. NCBI nr
Match: QJE38167.1 (NADH dehydrogenase subunit 1 [Cannabis sativa]) HSP 1 Score: 166.8 bits (421), Expect = 8.7e-38 Identity = 83/87 (95.40%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of Cmc00g0001331 vs. NCBI nr
Match: OAO89164.1 (hypothetical protein AXX17_ATUG03670 [Arabidopsis thaliana]) HSP 1 Score: 165.6 bits (418), Expect = 1.9e-37 Identity = 82/87 (94.25%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy Swiss-Prot
Match: P08834 (NADH-ubiquinone oxidoreductase chain 1 OS=Citrullus lanatus OX=3654 GN=ND1 PE=2 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 6.3e-31 Identity = 67/70 (95.71%), Postives = 67/70 (95.71%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy Swiss-Prot
Match: Q01300 (NADH-ubiquinone oxidoreductase chain 1 OS=Petunia hybrida OX=4102 GN=ND1 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.8e-23 Identity = 60/85 (70.59%), Postives = 64/85 (75.29%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy Swiss-Prot
Match: P92558 (NADH-ubiquinone oxidoreductase chain 1 OS=Arabidopsis thaliana OX=3702 GN=ND1 PE=1 SV=4) HSP 1 Score: 100.5 bits (249), Expect = 1.0e-20 Identity = 57/85 (67.06%), Postives = 59/85 (69.41%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy Swiss-Prot
Match: P31839 (NADH-ubiquinone oxidoreductase chain 1 OS=Oenothera berteroana OX=3950 GN=ND1 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.0e-20 Identity = 57/85 (67.06%), Postives = 59/85 (69.41%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy Swiss-Prot
Match: Q01148 (NADH-ubiquinone oxidoreductase chain 1 OS=Triticum aestivum OX=4565 GN=ND1 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.0e-20 Identity = 57/85 (67.06%), Postives = 59/85 (69.41%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy TrEMBL
Match: A0A5A7TCA6 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold77471G00010 PE=3 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.2e-42 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy TrEMBL
Match: A0A2I0I9H8 (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_038962 PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.5e-38 Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy TrEMBL
Match: A0A650GB61 (NADH-ubiquinone oxidoreductase chain 1 OS=Raphanus sativus OX=3726 GN=orf128a PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.9e-38 Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy TrEMBL
Match: A0A6M3TXR2 (NADH-ubiquinone oxidoreductase chain 1 OS=Cannabis sativa OX=3483 GN=nad1 PE=3 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 4.2e-38 Identity = 83/87 (95.40%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of Cmc00g0001331 vs. ExPASy TrEMBL
Match: A0A088BG09 (NADH-ubiquinone oxidoreductase chain 1 OS=Eruca vesicaria subsp. sativa OX=29727 GN=orf128 PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 9.4e-38 Identity = 82/87 (94.25%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of Cmc00g0001331 vs. TAIR 10
Match: ATMG01120.1 (NADH dehydrogenase 1B ) HSP 1 Score: 100.1 bits (248), Expect = 9.3e-22 Identity = 48/50 (96.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of Cmc00g0001331 vs. TAIR 10
Match: ATMG00516.1 (NADH dehydrogenase 1C ) HSP 1 Score: 100.1 bits (248), Expect = 9.3e-22 Identity = 48/50 (96.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of Cmc00g0001331 vs. TAIR 10
Match: ATMG01275.1 (NADH dehydrogenase 1A ) HSP 1 Score: 100.1 bits (248), Expect = 9.3e-22 Identity = 48/50 (96.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of Cmc00g0001331 vs. TAIR 10
Match: ATCG01100.1 (NADH dehydrogenase family protein ) HSP 1 Score: 47.8 bits (112), Expect = 5.5e-06 Identity = 21/34 (61.76%), Postives = 25/34 (73.53%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|