![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmaCh14G007740 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCTCCGTCACCGACATCCGCAAGGCTCAACGAGCCAATGGCCCCCCTATCATTCTCGCCATCGACACCGCTGCACCCCAACATCATTCTCTAGTCTGGCTATCTCAACTTCTACTTTCGCATAACTAATTCCAAGCATATGACTATCCTCAAGGACAAATTTGTTCGAATGCATATGTAAACAACGGTTTACTGATATTTATTTATTTAATCCACAGTTAACAGAGATATACTGATGTTCATGAATTACATTATTGAATTTATTAGAATAATTCCGCTAAATTTTGAGAAATGTTATTATGACATTGACATGCAAGTGAGAAGTCTATGATCAGGAAGCGTCACATGTACCTAACGGAGGAAATTCTTAAAGAGAATCAAATATGTGCGAGCACTTGGCACCTTCTCTAG ATGGCCTCCGTCACCGACATCCGCAAGGCTCAACGAGCCAATGGCCCCCCTATCATTCTCGCCATCGACACCGCTGCACCCCAACATCATTCTCTATCTATGATCAGGAAGCGTCACATGTACCTAACGGAGGAAATTCTTAAAGAGAATCAAATATGTGCGAGCACTTGGCACCTTCTCTAG ATGGCCTCCGTCACCGACATCCGCAAGGCTCAACGAGCCAATGGCCCCCCTATCATTCTCGCCATCGACACCGCTGCACCCCAACATCATTCTCTATCTATGATCAGGAAGCGTCACATGTACCTAACGGAGGAAATTCTTAAAGAGAATCAAATATGTGCGAGCACTTGGCACCTTCTCTAG MASVTDIRKAQRANGPPIILAIDTAAPQHHSLSMIRKRHMYLTEEILKENQICASTWHLL Homology
BLAST of CmaCh14G007740 vs. ExPASy Swiss-Prot
Match: Q9XJ57 (Chalcone synthase 2 OS=Citrus sinensis OX=2711 GN=CHS2 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.2e-07 Identity = 36/85 (42.35%), Postives = 43/85 (50.59%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy Swiss-Prot
Match: Q01288 (Chalcone synthase 6 OS=Pisum sativum OX=3888 GN=CHS6 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 7.2e-07 Identity = 35/80 (43.75%), Postives = 43/80 (53.75%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy Swiss-Prot
Match: O22046 (Chalcone synthase E OS=Ipomoea nil OX=35883 GN=CHSE PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 9.4e-07 Identity = 36/85 (42.35%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy Swiss-Prot
Match: P48386 (Chalcone synthase 1 OS=Camellia sinensis OX=4442 GN=CHS1 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.2e-06 Identity = 35/84 (41.67%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy Swiss-Prot
Match: Q9SEP4 (Chalcone synthase OS=Arabis alpina OX=50452 GN=CHS PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.2e-06 Identity = 36/83 (43.37%), Postives = 43/83 (51.81%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy TrEMBL
Match: A0A444ZE79 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_B04g070019 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 4.0e-08 Identity = 34/55 (61.82%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy TrEMBL
Match: V7CIC8 (Chal_sti_synt_N domain-containing protein (Fragment) OS=Phaseolus vulgaris OX=3885 GN=PHAVU_002G0392001g PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 2.6e-07 Identity = 34/55 (61.82%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy TrEMBL
Match: A0A6J1F2F9 (chalcone synthase-like OS=Cucurbita moschata OX=3662 GN=LOC111441532 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 5.7e-07 Identity = 41/80 (51.25%), Postives = 44/80 (55.00%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy TrEMBL
Match: A0A6J1F1I9 (chalcone synthase 2 isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111441531 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.7e-06 Identity = 40/85 (47.06%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of CmaCh14G007740 vs. ExPASy TrEMBL
Match: A0A6J1F7E0 (chalcone synthase 2 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111441531 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.7e-06 Identity = 40/85 (47.06%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of CmaCh14G007740 vs. NCBI nr
Match: RYR12477.1 (hypothetical protein Ahy_B04g070019 isoform D [Arachis hypogaea]) HSP 1 Score: 66.6 bits (161), Expect = 8.2e-08 Identity = 34/55 (61.82%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of CmaCh14G007740 vs. NCBI nr
Match: XP_007157051.1 (hypothetical protein PHAVU_002G0392001g, partial [Phaseolus vulgaris] >ESW29045.1 hypothetical protein PHAVU_002G0392001g, partial [Phaseolus vulgaris]) HSP 1 Score: 63.9 bits (154), Expect = 5.3e-07 Identity = 34/55 (61.82%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of CmaCh14G007740 vs. NCBI nr
Match: XP_022934337.1 (chalcone synthase-like [Cucurbita moschata]) HSP 1 Score: 62.8 bits (151), Expect = 1.2e-06 Identity = 41/80 (51.25%), Postives = 44/80 (55.00%), Query Frame = 0
BLAST of CmaCh14G007740 vs. NCBI nr
Match: KAG4990820.1 (hypothetical protein JHK87_024277 [Glycine soja]) HSP 1 Score: 61.6 bits (148), Expect = 2.6e-06 Identity = 34/59 (57.63%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of CmaCh14G007740 vs. NCBI nr
Match: XP_022934336.1 (chalcone synthase 2 isoform X2 [Cucurbita moschata]) HSP 1 Score: 61.2 bits (147), Expect = 3.4e-06 Identity = 40/85 (47.06%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of CmaCh14G007740 vs. TAIR 10
Match: AT5G13930.1 (Chalcone and stilbene synthase family protein ) HSP 1 Score: 52.0 bits (123), Expect = 1.9e-07 Identity = 35/84 (41.67%), Postives = 44/84 (52.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|