![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmaCh09G008680 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAGCACTAATCTCCTCCGTTTCCCTCTCCTTCATCTCCACTCCCGGCCGCCGTCCACTCTCTTTTTTCCTGCCATTAAATCGCATCTCTCCGTCGTATCGATCGCTTTTCCGACCTCTCAGTTCCTTCGTAACCCTTCCCATGGTCCGGCAAGGTTCGCGCTCATGGCAAAGCCTCCAAAAAGCGACAGCACGGAGCAGAAATGGAGCTACGAAGGCTCTATCGTCGAGTCTCTCCCCAATGGGATGTTCAGAGTTCGATTGGATAATGAAGACCTCATTCTTGGCTACATATGTGGTAAAATTCGGAAGAATTTTGTGCGTATTTTGCCTGGTGATAGGGTTAGGGTTGAAGTTAGCCGTTATGATTCTACTAAAGGCCGTATTGTCTATAGAAATCGAAGCAGTACTTAG ATGTCGAGCACTAATCTCCTCCGTTTCCCTCTCCTTCATCTCCACTCCCGGCCGCCGTCCACTCTCTTTTTTCCTGCCATTAAATCGCATCTCTCCGTCGTATCGATCGCTTTTCCGACCTCTCAGTTCCTTCGTAACCCTTCCCATGGTCCGGCAAGGTTCGCGCTCATGGCAAAGCCTCCAAAAAGCGACAGCACGGAGCAGAAATGGAGCTACGAAGGCTCTATCGTCGAGTCTCTCCCCAATGGGATGTTCAGAGTTCGATTGGATAATGAAGACCTCATTCTTGGCTACATATGTGGTAAAATTCGGAAGAATTTTGTGCGTATTTTGCCTGGTGATAGGGTTAGGGTTGAAGTTAGCCGTTATGATTCTACTAAAGGCCGTATTGTCTATAGAAATCGAAGCAGTACTTAG ATGTCGAGCACTAATCTCCTCCGTTTCCCTCTCCTTCATCTCCACTCCCGGCCGCCGTCCACTCTCTTTTTTCCTGCCATTAAATCGCATCTCTCCGTCGTATCGATCGCTTTTCCGACCTCTCAGTTCCTTCGTAACCCTTCCCATGGTCCGGCAAGGTTCGCGCTCATGGCAAAGCCTCCAAAAAGCGACAGCACGGAGCAGAAATGGAGCTACGAAGGCTCTATCGTCGAGTCTCTCCCCAATGGGATGTTCAGAGTTCGATTGGATAATGAAGACCTCATTCTTGGCTACATATGTGGTAAAATTCGGAAGAATTTTGTGCGTATTTTGCCTGGTGATAGGGTTAGGGTTGAAGTTAGCCGTTATGATTCTACTAAAGGCCGTATTGTCTATAGAAATCGAAGCAGTACTTAG MSSTNLLRFPLLHLHSRPPSTLFFPAIKSHLSVVSIAFPTSQFLRNPSHGPARFALMAKPPKSDSTEQKWSYEGSIVESLPNGMFRVRLDNEDLILGYICGKIRKNFVRILPGDRVRVEVSRYDSTKGRIVYRNRSST Homology
BLAST of CmaCh09G008680 vs. ExPASy Swiss-Prot
Match: Q94KR7 (Translation initiation factor IF-1, chloroplastic OS=Glycine max OX=3847 GN=infA PE=2 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.5e-31 Identity = 86/144 (59.72%), Postives = 94/144 (65.28%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy Swiss-Prot
Match: Q94KR9 (Translation initiation factor IF-1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=infA PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.0e-27 Identity = 55/71 (77.46%), Postives = 66/71 (92.96%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy Swiss-Prot
Match: A0A370 (Translation initiation factor IF-1, chloroplastic OS=Coffea arabica OX=13443 GN=infA PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.3e-27 Identity = 55/70 (78.57%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy Swiss-Prot
Match: Q09G11 (Translation initiation factor IF-1, chloroplastic OS=Platanus occidentalis OX=4403 GN=infA PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.3e-27 Identity = 56/70 (80.00%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy Swiss-Prot
Match: Q7ICQ5 (Translation initiation factor IF-1, chloroplastic OS=Fouquieria splendens OX=13533 GN=infA PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.9e-27 Identity = 55/70 (78.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy TrEMBL
Match: A0A6J1IP00 (uncharacterized protein LOC111476947 OS=Cucurbita maxima OX=3661 GN=LOC111476947 PE=3 SV=1) HSP 1 Score: 279.3 bits (713), Expect = 9.0e-72 Identity = 138/138 (100.00%), Postives = 138/138 (100.00%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy TrEMBL
Match: A0A6J1FET6 (uncharacterized protein LOC111443299 OS=Cucurbita moschata OX=3662 GN=LOC111443299 PE=3 SV=1) HSP 1 Score: 266.5 bits (680), Expect = 6.0e-68 Identity = 132/138 (95.65%), Postives = 135/138 (97.83%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy TrEMBL
Match: A0A5A7V7J3 (Translation initiation factor IF-1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G003940 PE=3 SV=1) HSP 1 Score: 229.6 bits (584), Expect = 8.1e-57 Identity = 115/137 (83.94%), Postives = 123/137 (89.78%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy TrEMBL
Match: A0A6J1FLU6 (translation initiation factor IF-1, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111446393 PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 6.9e-56 Identity = 111/137 (81.02%), Postives = 123/137 (89.78%), Query Frame = 0
BLAST of CmaCh09G008680 vs. ExPASy TrEMBL
Match: A0A6J1IW62 (translation initiation factor IF-1, chloroplastic-like OS=Cucurbita maxima OX=3661 GN=LOC111480474 PE=3 SV=1) HSP 1 Score: 224.2 bits (570), Expect = 3.4e-55 Identity = 111/137 (81.02%), Postives = 122/137 (89.05%), Query Frame = 0
BLAST of CmaCh09G008680 vs. NCBI nr
Match: XP_022976599.1 (uncharacterized protein LOC111476947 [Cucurbita maxima]) HSP 1 Score: 279.3 bits (713), Expect = 1.9e-71 Identity = 138/138 (100.00%), Postives = 138/138 (100.00%), Query Frame = 0
BLAST of CmaCh09G008680 vs. NCBI nr
Match: XP_023535140.1 (uncharacterized protein LOC111796655 isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 270.8 bits (691), Expect = 6.6e-69 Identity = 134/138 (97.10%), Postives = 136/138 (98.55%), Query Frame = 0
BLAST of CmaCh09G008680 vs. NCBI nr
Match: KAG7024835.1 (Translation initiation factor IF-1, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 270.4 bits (690), Expect = 8.6e-69 Identity = 133/138 (96.38%), Postives = 137/138 (99.28%), Query Frame = 0
BLAST of CmaCh09G008680 vs. NCBI nr
Match: XP_022936830.1 (uncharacterized protein LOC111443299 [Cucurbita moschata]) HSP 1 Score: 266.5 bits (680), Expect = 1.2e-67 Identity = 132/138 (95.65%), Postives = 135/138 (97.83%), Query Frame = 0
BLAST of CmaCh09G008680 vs. NCBI nr
Match: XP_038899010.1 (translation initiation factor IF-1, chloroplastic [Benincasa hispida]) HSP 1 Score: 235.3 bits (599), Expect = 3.1e-58 Identity = 117/138 (84.78%), Postives = 125/138 (90.58%), Query Frame = 0
BLAST of CmaCh09G008680 vs. TAIR 10
Match: AT4G11175.1 (Nucleic acid-binding, OB-fold-like protein ) HSP 1 Score: 105.9 bits (263), Expect = 2.6e-23 Identity = 54/87 (62.07%), Postives = 65/87 (74.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|