CmaCh04G019040 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCACGTCGAGGTACTGCAGAAGAAAAAATTGCAAAATCCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACTATCTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAAGCGGATCAACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTCCGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTAA ATGTCACGTCGAGGTACTGCAGAAGAAAAAATTGCAAAATCCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACTATCTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAAGCGGATCAACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTCCGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTAA ATGTCACGTCGAGGTACTGCAGAAGAAAAAATTGCAAAATCCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACTATCTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAAGCGGATCAACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTCCGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTAA MSRRGTAEEKIAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVSGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Homology
BLAST of CmaCh04G019040 vs. ExPASy Swiss-Prot
Match: Q49KT8 (30S ribosomal protein S7, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rps7-A PE=3 SV=1) HSP 1 Score: 293.1 bits (749), Expect = 1.8e-78 Identity = 153/155 (98.71%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy Swiss-Prot
Match: B1NWJ5 (30S ribosomal protein S7, chloroplastic OS=Manihot esculenta OX=3983 GN=rps7-A PE=3 SV=1) HSP 1 Score: 293.1 bits (749), Expect = 1.8e-78 Identity = 153/155 (98.71%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy Swiss-Prot
Match: P07135 (30S ribosomal protein S7, chloroplastic OS=Glycine max OX=3847 GN=rps7-A PE=3 SV=1) HSP 1 Score: 292.7 bits (748), Expect = 2.4e-78 Identity = 152/155 (98.06%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy Swiss-Prot
Match: Q6EM99 (30S ribosomal protein S7, chloroplastic OS=Euonymus alatus OX=4307 GN=rps7 PE=3 SV=1) HSP 1 Score: 292.4 bits (747), Expect = 3.1e-78 Identity = 152/155 (98.06%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy Swiss-Prot
Match: A4QJG0 (30S ribosomal protein S7, chloroplastic OS=Aethionema cordifolium OX=434059 GN=rps7-A PE=3 SV=1) HSP 1 Score: 292.0 bits (746), Expect = 4.1e-78 Identity = 152/155 (98.06%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy TrEMBL
Match: A0A2H4T230 (30S ribosomal protein S7, chloroplastic OS=Cucurbita maxima OX=3661 GN=rps7 PE=3 SV=1) HSP 1 Score: 296.6 bits (758), Expect = 6.1e-77 Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy TrEMBL
Match: A0A344AXT4 (30S ribosomal protein S7, chloroplastic OS=Cucurbita pepo OX=3663 GN=rps7 PE=3 SV=1) HSP 1 Score: 296.6 bits (758), Expect = 6.1e-77 Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy TrEMBL
Match: A0A6H0EV75 (30S ribosomal protein S7, chloroplastic OS=Cionosicys macranthus OX=386150 GN=rps7 PE=3 SV=1) HSP 1 Score: 296.6 bits (758), Expect = 6.1e-77 Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy TrEMBL
Match: A0A0S2IFI9 (Ribosomal protein S7 OS=Cucurbita moschata OX=3662 GN=rps7 PE=3 SV=1) HSP 1 Score: 296.6 bits (758), Expect = 6.1e-77 Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 0
BLAST of CmaCh04G019040 vs. ExPASy TrEMBL
Match: A0A0S2IDL8 (Ribosomal protein S7 OS=Cucurbita argyrosperma OX=34294 GN=rps7 PE=3 SV=1) HSP 1 Score: 296.6 bits (758), Expect = 6.1e-77 Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 0
BLAST of CmaCh04G019040 vs. NCBI nr
Match: YP_009447496.1 (ribosomal protein S7 [Cucurbita maxima] >YP_009447511.1 ribosomal protein S7 [Cucurbita maxima] >YP_009447581.1 ribosomal protein S7 [Cucurbita moschata] >YP_009447596.1 ribosomal protein S7 [Cucurbita moschata] >YP_009505125.1 ribosomal protein S7 [Cucurbita pepo] >YP_009505140.1 ribosomal protein S7 [Cucurbita pepo] >YP_009752035.1 ribosomal protein S7 [Cionosicys macranthus] >YP_009752049.1 ribosomal protein S7 [Cionosicys macranthus] >ALO21753.1 ribosomal protein S7 [Cucurbita argyrosperma] >ALO21825.1 ribosomal protein S7 [Cucurbita argyrosperma var. palmeri] >ALO21886.1 ribosomal protein S7 [Cucurbita argyrosperma subsp. sororia] >ALO21935.1 ribosomal protein S7 [Cucurbita cordata] >ALO21969.1 ribosomal protein S7 [Cucurbita digitata] >ALO22036.1 ribosomal protein S7 [Cucurbita ecuadorensis] >ALO22090.1 ribosomal protein S7 [Cucurbita ficifolia] >ALO22172.1 ribosomal protein S7 [Cucurbita foetidissima] >ALO22269.1 ribosomal protein S7 [Cucurbita lundelliana] >ALO22317.1 ribosomal protein S7 [Cucurbita maxima subsp. andreana] >ALO22419.1 ribosomal protein S7 [Cucurbita okeechobeensis] >ALO22504.1 ribosomal protein S7 [Cucurbita okeechobeensis subsp. martinezii] >ALO22576.1 ribosomal protein S7 [Cucurbita pepo subsp. fraterna] >ALO22627.1 ribosomal protein S7 [Cucurbita pepo subsp. ovifera] >ALO22709.1 ribosomal protein S7 [Cucurbita pepo var. ozarkana] >ALO22755.1 ribosomal protein S7 [Cucurbita pepo subsp. pepo] >ALO22799.1 ribosomal protein S7 [Cucurbita pepo var. texana] >ALO22879.1 ribosomal protein S7 [Cucurbita pedatifolia]) HSP 1 Score: 296.6 bits (758), Expect = 1.3e-76 Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 0
BLAST of CmaCh04G019040 vs. NCBI nr
Match: WP_131767149.1 (30S ribosomal protein S7 [Candidatus Frankia datiscae] >YP_004841829.1 ribosomal protein S7 [Cucumis melo subsp. melo] >YP_004841845.1 ribosomal protein S7 [Cucumis melo subsp. melo] >YP_009236323.1 ribosomal protein S7 [Gynostemma pentaphyllum] >YP_009236335.1 ribosomal protein S7 [Gynostemma pentaphyllum] >YP_009317431.1 ribosomal protein S7 [Coccinia grandis] >YP_009317445.1 ribosomal protein S7 [Coccinia grandis] >YP_009326035.1 ribosomal protein S7 [Citrullus lanatus] >YP_009326050.1 ribosomal protein S7 [Citrullus lanatus] >YP_009348077.1 ribosomal protein S7 [Citrullus mucosospermus] >YP_009348092.1 ribosomal protein S7 [Citrullus mucosospermus] >YP_009420840.1 ribosomal protein S7 [Citrullus colocynthis] >YP_009420855.1 ribosomal protein S7 [Citrullus colocynthis] >YP_009430672.1 ribosomal protein S7 [Gynostemma cardiospermum] >YP_009430688.1 ribosomal protein S7 [Gynostemma cardiospermum] >YP_009431602.1 ribosomal protein S7 [Citrullus amarus] >YP_009431617.1 ribosomal protein S7 [Citrullus amarus] >YP_009431688.1 ribosomal protein S7 [Citrullus rehmii] >YP_009431703.1 ribosomal protein S7 [Citrullus rehmii] >YP_009439849.1 ribosomal protein S7 [Gynostemma laxiflorum] >YP_009439865.1 ribosomal protein S7 [Gynostemma laxiflorum] >YP_009440023.1 ribosomal protein S7 [Gynostemma pentagynum] >YP_009440039.1 ribosomal protein S7 [Gynostemma pentagynum] >YP_009440202.1 ribosomal protein S7 [Gynostemma longipes] >YP_009440218.1 ribosomal protein S7 [Gynostemma longipes] >YP_009440289.1 ribosomal protein S7 [Gynostemma burmanicum (nom. inval.)] >YP_009440305.1 ribosomal protein S7 [Gynostemma burmanicum (nom. inval.)] >YP_009440376.1 ribosomal protein S7 [Gynostemma pubescens] >YP_009440392.1 ribosomal protein S7 [Gynostemma pubescens] >YP_009456106.1 ribosomal protein S7 [Momordica charantia] >YP_009456122.1 ribosomal protein S7 [Momordica charantia] >YP_009456191.1 ribosomal protein S7 [Lagenaria siceraria] >YP_009456207.1 ribosomal protein S7 [Lagenaria siceraria] >YP_009468906.1 ribosomal protein S7 [Gynostemma compressum] >YP_009468922.1 ribosomal protein S7 [Gynostemma compressum] >YP_009525231.1 ribosomal protein S7 [Hodgsonia macrocarpa] >YP_009525244.1 ribosomal protein S7 [Hodgsonia macrocarpa] >YP_009526347.1 ribosomal protein S7 [Hemsleya lijiangensis] >YP_009526363.1 ribosomal protein S7 [Hemsleya lijiangensis] >YP_009560881.1 ribosomal protein S7 [Trichosanthes kirilowii] >YP_009560894.1 ribosomal protein S7 [Trichosanthes kirilowii] >YP_009669949.1 ribosomal protein S7 [Salvertia convallariodora] >YP_009669965.1 ribosomal protein S7 [Salvertia convallariodora] >YP_009674436.1 ribosomal protein S7 [Siraitia grosvenorii] >YP_009674451.1 ribosomal protein S7 [Siraitia grosvenorii] >YP_009707934.1 ribosomal protein S7 [Begonia pulchrifolia] >YP_009707950.1 ribosomal protein S7 [Begonia pulchrifolia] >YP_009738248.1 ribosomal protein S7 [Siraitia siamensis] >YP_009738263.1 ribosomal protein S7 [Siraitia siamensis] >YP_009751530.1 ribosomal protein S7 [Thladiantha dubia] >YP_009751544.1 ribosomal protein S7 [Thladiantha dubia] >YP_009751698.1 ribosomal protein S7 [Hodgsonia heteroclita] >YP_009751712.1 ribosomal protein S7 [Hodgsonia heteroclita] >YP_009751783.1 ribosomal protein S7 [Herpetospermum pedunculosum] >YP_009751796.1 ribosomal protein S7 [Herpetospermum pedunculosum] >YP_009751867.1 ribosomal protein S7 [Indofevillea khasiana] >YP_009751880.1 ribosomal protein S7 [Indofevillea khasiana] >YP_009751951.1 ribosomal protein S7 [Cyclanthera pedata] >YP_009751964.1 ribosomal protein S7 [Cyclanthera pedata] >YP_009752120.1 ribosomal protein S7 [Dendrosicyos socotranus] >YP_009752133.1 ribosomal protein S7 [Dendrosicyos socotranus] >YP_009752203.1 ribosomal protein S7 [Linnaeosicyos amara] >YP_009752288.1 ribosomal protein S7 [Trichosanthes baviensis] >YP_009752301.1 ribosomal protein S7 [Trichosanthes baviensis] >YP_009752372.1 ribosomal protein S7 [Bryonia marmorata] >YP_009752386.1 ribosomal protein S7 [Bryonia marmorata] >YP_009752457.1 ribosomal protein S7 [Trichosanthes tricuspidata] >YP_009752470.1 ribosomal protein S7 [Trichosanthes tricuspidata] >YP_009752541.1 ribosomal protein S7 [Trichosanthes tubiflora] >YP_009752555.1 ribosomal protein S7 [Trichosanthes tubiflora] >YP_009752626.1 ribosomal protein S7 [Trichosanthes homophylla] >YP_009752640.1 ribosomal protein S7 [Trichosanthes homophylla] >YP_009752711.1 ribosomal protein S7 [Ampelosycios humblotii] >YP_009752724.1 ribosomal protein S7 [Ampelosycios humblotii] >YP_009752880.1 ribosomal protein S7 [Baijiania yunnanensis] >YP_009752894.1 ribosomal protein S7 [Baijiania yunnanensis] >YP_009752965.1 ribosomal protein S7 [Momordica sessilifolia] >YP_009752978.1 ribosomal protein S7 [Momordica sessilifolia] >YP_009753049.1 ribosomal protein S7 [Gerrardanthus macrorhizus] >YP_009753063.1 ribosomal protein S7 [Gerrardanthus macrorhizus] >YP_009753219.1 ribosomal protein S7 [Trichosanthes truncata] >YP_009753232.1 ribosomal protein S7 [Trichosanthes truncata] >YP_009753302.1 ribosomal protein S7 [Nothoalsomitra suberosa] >YP_009753316.1 ribosomal protein S7 [Nothoalsomitra suberosa] >YP_009753665.1 ribosomal protein S7 [Trichosanthes wallichiana] >YP_009753679.1 ribosomal protein S7 [Trichosanthes wallichiana] >YP_009753750.1 ribosomal protein S7 [Trichosanthes nervifolia] >YP_009753763.1 ribosomal protein S7 [Trichosanthes nervifolia] >YP_009753834.1 ribosomal protein S7 [Trichosanthes pilosa] >YP_009753848.1 ribosomal protein S7 [Trichosanthes pilosa] >YP_009753919.1 ribosomal protein S7 [Trichosanthes lobata] >YP_009753933.1 ribosomal protein S7 [Trichosanthes lobata] >YP_009775179.1 ribosomal protein S7 [Begonia versicolor] >YP_009775192.1 ribosomal protein S7 [Begonia versicolor] >YP_009860119.1 ribosomal protein S7 [Cucumis melo subsp. agrestis] >YP_009860135.1 ribosomal protein S7 [Cucumis melo subsp. agrestis] >YP_009945460.1 ribosomal protein S7 [Sechium edule] >YP_009945471.1 ribosomal protein S7 [Sechium edule] >YP_010015184.1 ribosomal protein S7 [Gynostemma yixingense] >YP_010015200.1 ribosomal protein S7 [Gynostemma yixingense] >YP_010117490.1 ribosomal protein S7 [Begonia coptidifolia] >YP_010117561.1 ribosomal protein S7 [Begonia coptidifolia] >YP_010119779.1 ribosomal protein S7 [Hemsleya zhejiangensis] >YP_010119794.1 ribosomal protein S7 [Hemsleya zhejiangensis] >YP_010131139.1 ribosomal protein S7 [Benincasa hispida] >YP_010131152.1 ribosomal protein S7 [Benincasa hispida] >APW82508.1 ribosomal protein S7 [Citrullus lanatus subsp. vulgaris] >ASY96646.1 ribosomal protein S7 [Cucumis melo var. conomon] >ASY96734.1 ribosomal protein S7 [Cucumis melo var. makuwa] >ASY96821.1 ribosomal protein S7 [Cucumis melo var. momordica] >ASY96908.1 ribosomal protein S7 [Cucumis melo var. dudaim] >ASY96995.1 ribosomal protein S7 [Cucumis melo var. cantalupo] >ASY97169.1 ribosomal protein S7 [Cucumis melo var. inodorus] >ASY97343.1 ribosomal protein S7 [Cucumis melo var. flexuosus] >AXU40435.1 ribosomal protein S7 [Gomphogyne cissiformis var. villosa] >AXU40609.1 ribosomal protein S7 [Gomphogyne cissiformis var. cissiformis] >QIT04095.1 ribosomal protein S7 [Luffa aegyptiaca] >QJD26515.1 ribosomal protein S7 [Trichosanthes kirilowii var. japonica] >QJD26689.1 ribosomal protein S7 [Trichosanthes rosthornii] >QJF46430.1 ribosomal protein S7 [Cucumis melo] >QKX48520.1 ribosomal protein S7 [Luffa acutangula] >QNM38576.1 ribosomal protein S7 [Lagenaria siceraria var. microcarpa] >QZL38639.1 ribosomal protein S7 [Citrullus naudinianus] >QZL38727.1 ribosomal protein S7 [Citrullus ecirrhosus]) HSP 1 Score: 295.0 bits (754), Expect = 3.7e-76 Identity = 154/155 (99.35%), Postives = 154/155 (99.35%), Query Frame = 0
BLAST of CmaCh04G019040 vs. NCBI nr
Match: YP_009415262.1 (ribosomal protein S7 [Musella lasiocarpa] >YP_009415278.1 ribosomal protein S7 [Musella lasiocarpa] >AMC32664.1 ribosomal protein S7 [Euphorbia marginata] >AYP33014.1 ribosomal protein S7 [Ensete superbum] >QXF60505.1 ribosomal protein S7 [Ensete glaucum] >ASL69909.1 ribosomal protein S7 [Musella lasiocarpa] >ASL69925.1 ribosomal protein S7 [Musella lasiocarpa]) HSP 1 Score: 294.7 bits (753), Expect = 4.8e-76 Identity = 154/155 (99.35%), Postives = 154/155 (99.35%), Query Frame = 0
BLAST of CmaCh04G019040 vs. NCBI nr
Match: YP_009763087.1 (ribosomal protein S7 [Mallotus peltatus] >YP_009763096.1 ribosomal protein S7 [Mallotus peltatus] >QQV39218.1 ribosomal protein S7 [Macaranga tanarius] >QZN08105.1 ribosomal protein S7 [Mallotus paniculatus] >QIR63426.1 ribosomal protein S7 [Mallotus peltatus] >QIR63435.1 ribosomal protein S7 [Mallotus peltatus] >QQV39230.1 ribosomal protein S7 [Macaranga tanarius]) HSP 1 Score: 294.7 bits (753), Expect = 4.8e-76 Identity = 153/155 (98.71%), Postives = 154/155 (99.35%), Query Frame = 0
BLAST of CmaCh04G019040 vs. NCBI nr
Match: YP_004072507.1 (ribosomal protein S7 [Corynocarpus laevigatus] >YP_004072519.1 ribosomal protein S7 [Corynocarpus laevigatus] >ADO60355.1 ribosomal protein S7 [Corynocarpus laevigatus] >ADO60367.1 ribosomal protein S7 [Corynocarpus laevigatus]) HSP 1 Score: 294.3 bits (752), Expect = 6.2e-76 Identity = 153/155 (98.71%), Postives = 154/155 (99.35%), Query Frame = 0
BLAST of CmaCh04G019040 vs. TAIR 10
Match: ATCG01240.1 (ribosomal protein S7 ) HSP 1 Score: 292.0 bits (746), Expect = 2.9e-79 Identity = 152/155 (98.06%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. TAIR 10
Match: ATCG00900.1 (Ribosomal protein S7p/S5e family protein ) HSP 1 Score: 292.0 bits (746), Expect = 2.9e-79 Identity = 152/155 (98.06%), Postives = 153/155 (98.71%), Query Frame = 0
BLAST of CmaCh04G019040 vs. TAIR 10
Match: AT2G07696.1 (Ribosomal protein S7p/S5e family protein ) HSP 1 Score: 71.6 bits (174), Expect = 6.1e-13 Identity = 45/140 (32.14%), Postives = 79/140 (56.43%), Query Frame = 0
BLAST of CmaCh04G019040 vs. TAIR 10
Match: ATMG01270.1 (mitochondrial ribosomal protein S7 ) HSP 1 Score: 71.6 bits (174), Expect = 6.1e-13 Identity = 45/140 (32.14%), Postives = 79/140 (56.43%), Query Frame = 0
BLAST of CmaCh04G019040 vs. TAIR 10
Match: AT2G37270.2 (ribosomal protein 5B ) HSP 1 Score: 54.3 bits (129), Expect = 1.0e-07 Identity = 45/134 (33.58%), Postives = 71/134 (52.99%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|