![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmaCh04G002060 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAGAAATGGAAGCTGCCCAAGAAAGAGGCTCCGACGAGAACCCGATCATCTTCTTCTTCCTGTCCTCTGATGAGAAATTCTTCTGAGAGGAGGCGTTCTTTTACCAGAAAATGTGCCAAATTGGTAAAAGAACAAAGGGCTCGATTTTACATCATGAGGCGCTGTGTTGCCATGCTCATCTGTTGGCATAACTACAGCGATTCATGA ATGGAGGAGAAATGGAAGCTGCCCAAGAAAGAGGCTCCGACGAGAACCCGATCATCTTCTTCTTCCTGTCCTCTGATGAGAAATTCTTCTGAGAGGAGGCGTTCTTTTACCAGAAAATGTGCCAAATTGGTAAAAGAACAAAGGGCTCGATTTTACATCATGAGGCGCTGTGTTGCCATGCTCATCTGTTGGCATAACTACAGCGATTCATGA ATGGAGGAGAAATGGAAGCTGCCCAAGAAAGAGGCTCCGACGAGAACCCGATCATCTTCTTCTTCCTGTCCTCTGATGAGAAATTCTTCTGAGAGGAGGCGTTCTTTTACCAGAAAATGTGCCAAATTGGTAAAAGAACAAAGGGCTCGATTTTACATCATGAGGCGCTGTGTTGCCATGCTCATCTGTTGGCATAACTACAGCGATTCATGA MEEKWKLPKKEAPTRTRSSSSSCPLMRNSSERRRSFTRKCAKLVKEQRARFYIMRRCVAMLICWHNYSDS Homology
BLAST of CmaCh04G002060 vs. ExPASy Swiss-Prot
Match: Q8S8S3 (Small polypeptide DEVIL 11 OS=Arabidopsis thaliana OX=3702 GN=DVL11 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.7e-15 Identity = 47/73 (64.38%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy Swiss-Prot
Match: Q8L7D0 (Small polypeptide DEVIL 13 OS=Arabidopsis thaliana OX=3702 GN=DVL13 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-09 Identity = 35/70 (50.00%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy Swiss-Prot
Match: Q6IM93 (Small polypeptide DEVIL 8 OS=Arabidopsis thaliana OX=3702 GN=DVL8 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.1e-09 Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy Swiss-Prot
Match: Q8LE84 (Small polypeptide DEVIL 18 OS=Arabidopsis thaliana OX=3702 GN=DVL18 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.3e-09 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy Swiss-Prot
Match: Q6IM92 (Small polypeptide DEVIL 9 OS=Arabidopsis thaliana OX=3702 GN=DVL9 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.8e-08 Identity = 39/105 (37.14%), Postives = 53/105 (50.48%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy TrEMBL
Match: A0A5A7U4Z4 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold293G00470 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.5e-27 Identity = 64/70 (91.43%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy TrEMBL
Match: A0A0A0KQA4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G182670 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.5e-27 Identity = 64/70 (91.43%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy TrEMBL
Match: A0A1S3CF72 (uncharacterized protein LOC103500229 OS=Cucumis melo OX=3656 GN=LOC103500229 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.5e-27 Identity = 64/70 (91.43%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy TrEMBL
Match: A0A6J1CBU5 (uncharacterized protein LOC111010130 OS=Momordica charantia OX=3673 GN=LOC111010130 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 6.7e-23 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of CmaCh04G002060 vs. ExPASy TrEMBL
Match: A0A2C9V2X7 (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_10G028700 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 5.8e-19 Identity = 53/68 (77.94%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of CmaCh04G002060 vs. NCBI nr
Match: KAG6600989.1 (hypothetical protein SDJN03_06222, partial [Cucurbita argyrosperma subsp. sororia] >KAG7031601.1 hypothetical protein SDJN02_05642, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 130.6 bits (327), Expect = 5.4e-27 Identity = 65/70 (92.86%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. NCBI nr
Match: XP_008461687.1 (PREDICTED: uncharacterized protein LOC103500229 [Cucumis melo] >KAA0050338.1 uncharacterized protein E6C27_scaffold88G00650 [Cucumis melo var. makuwa] >TYK03552.1 uncharacterized protein E5676_scaffold293G00470 [Cucumis melo var. makuwa]) HSP 1 Score: 129.8 bits (325), Expect = 9.2e-27 Identity = 64/70 (91.43%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. NCBI nr
Match: XP_038889639.1 (uncharacterized protein LOC120079504 [Benincasa hispida] >XP_038889640.1 uncharacterized protein LOC120079504 [Benincasa hispida] >XP_038889641.1 uncharacterized protein LOC120079504 [Benincasa hispida] >XP_038889642.1 uncharacterized protein LOC120079504 [Benincasa hispida]) HSP 1 Score: 129.4 bits (324), Expect = 1.2e-26 Identity = 64/70 (91.43%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. NCBI nr
Match: XP_022139156.1 (uncharacterized protein LOC111010130 [Momordica charantia]) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-22 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of CmaCh04G002060 vs. NCBI nr
Match: KAG8645050.1 (hypothetical protein MANES_10G028700v8 [Manihot esculenta] >OAY38611.1 hypothetical protein MANES_10G028700v8 [Manihot esculenta]) HSP 1 Score: 102.8 bits (255), Expect = 1.2e-18 Identity = 53/68 (77.94%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of CmaCh04G002060 vs. TAIR 10
Match: AT2G39705.1 (ROTUNDIFOLIA like 8 ) HSP 1 Score: 82.8 bits (203), Expect = 1.2e-16 Identity = 47/73 (64.38%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of CmaCh04G002060 vs. TAIR 10
Match: AT2G29125.1 (ROTUNDIFOLIA like 2 ) HSP 1 Score: 63.2 bits (152), Expect = 9.8e-11 Identity = 35/70 (50.00%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of CmaCh04G002060 vs. TAIR 10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7 ) HSP 1 Score: 62.0 bits (149), Expect = 2.2e-10 Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 0
BLAST of CmaCh04G002060 vs. TAIR 10
Match: AT5G59510.1 (ROTUNDIFOLIA like 5 ) HSP 1 Score: 61.2 bits (147), Expect = 3.7e-10 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 0
BLAST of CmaCh04G002060 vs. TAIR 10
Match: AT1G07490.1 (ROTUNDIFOLIA like 3 ) HSP 1 Score: 57.8 bits (138), Expect = 4.1e-09 Identity = 39/105 (37.14%), Postives = 53/105 (50.48%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|