![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmUC10G197230 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATCAATCTTCGACAATGTTTTACGCCAATGGTCAGGACAAGGAGATCATGGGTCAGCCATTCAAGACCTCGGATGGAAGTGCTCCAATATAGTTGTCTCCACCAAGATCTTTTGGGGCGGTCCTGGTCAGATCGGTAAGGGGCTTTCCAGAAAGCACATTGTTGAAGGCACCGAGGCTTCACTGAAGCAATTGGACATGGAGTATGTTGATGTTATAAAAAAATTTTAA ATGGCATCAATCTTCGACAATGTTTTACGCCAATGGTCAGGACAAGGAGATCATGGGTCAGCCATTCAAGACCTCGGATGGAAGTGCTCCAATATAGTTGTCTCCACCAAGATCTTTTGGGGCGGTCCTGGTCAGATCGGTAAGGGGCTTTCCAGAAAGCACATTGTTGAAGGCACCGAGGCTTCACTGAAGCAATTGGACATGGAGTATGTTGATGTTATAAAAAAATTTTAA ATGGCATCAATCTTCGACAATGTTTTACGCCAATGGTCAGGACAAGGAGATCATGGGTCAGCCATTCAAGACCTCGGATGGAAGTGCTCCAATATAGTTGTCTCCACCAAGATCTTTTGGGGCGGTCCTGGTCAGATCGGTAAGGGGCTTTCCAGAAAGCACATTGTTGAAGGCACCGAGGCTTCACTGAAGCAATTGGACATGGAGTATGTTGATGTTATAAAAAAATTTTAA MASIFDNVLRQWSGQGDHGSAIQDLGWKCSNIVVSTKIFWGGPGQIGKGLSRKHIVEGTEASLKQLDMEYVDVIKKF Homology
BLAST of CmUC10G197230 vs. NCBI nr
Match: KAD3337003.1 (hypothetical protein E3N88_32523 [Mikania micrantha] >KAD3337025.1 hypothetical protein E3N88_32545 [Mikania micrantha]) HSP 1 Score: 101.3 bits (251), Expect = 3.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. NCBI nr
Match: XP_038878068.1 (probable voltage-gated potassium channel subunit beta [Benincasa hispida]) HSP 1 Score: 101.3 bits (251), Expect = 3.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. NCBI nr
Match: OWM86474.1 (hypothetical protein CDL15_Pgr026366 [Punica granatum]) HSP 1 Score: 101.3 bits (251), Expect = 3.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. NCBI nr
Match: XP_004134014.1 (probable voltage-gated potassium channel subunit beta [Cucumis sativus] >KGN56765.1 hypothetical protein Csa_010532 [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 3.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. NCBI nr
Match: XP_024194075.1 (probable voltage-gated potassium channel subunit beta [Rosa chinensis] >PRQ36935.1 putative NADP-dependent oxidoreductase domain-containing protein [Rosa chinensis]) HSP 1 Score: 101.3 bits (251), Expect = 3.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy Swiss-Prot
Match: O23016 (Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.6e-20 Identity = 46/74 (62.16%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy Swiss-Prot
Match: Q40648 (Probable voltage-gated potassium channel subunit beta OS=Oryza sativa subsp. japonica OX=39947 GN=KOB1 PE=1 SV=2) HSP 1 Score: 90.5 bits (223), Expect = 8.9e-18 Identity = 42/74 (56.76%), Postives = 55/74 (74.32%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy Swiss-Prot
Match: Q27955 (Voltage-gated potassium channel subunit beta-2 OS=Bos taurus OX=9913 GN=KCNAB2 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-13 Identity = 31/56 (55.36%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy Swiss-Prot
Match: Q13303 (Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNAB2 PE=1 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-13 Identity = 31/56 (55.36%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy Swiss-Prot
Match: P62482 (Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-13 Identity = 31/56 (55.36%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy TrEMBL
Match: A0A2I0J6N1 (probable voltage-gated potassium channel subunit beta OS=Punica granatum OX=22663 GN=LOC116196930 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy TrEMBL
Match: A0A5N6M8P7 (Aldo_ket_red domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_32523 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy TrEMBL
Match: A0A5A7TZY1 (Putative voltage-gated potassium channel subunit beta OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G002470 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy TrEMBL
Match: A0A2P6QRW6 (Putative NADP-dependent oxidoreductase domain-containing protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0396981 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. ExPASy TrEMBL
Match: A0A0A0L457 (Aldo_ket_red domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G133160 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.9e-18 Identity = 50/74 (67.57%), Postives = 59/74 (79.73%), Query Frame = 0
BLAST of CmUC10G197230 vs. TAIR 10
Match: AT1G04690.1 (potassium channel beta subunit 1 ) HSP 1 Score: 97.8 bits (242), Expect = 4.0e-21 Identity = 46/74 (62.16%), Postives = 59/74 (79.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|