CmUC09G174780 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCATGCGCATTTACTATGATAACAAGGCATCAATCTCCATTGCCCACAATCCAGTCCTTCATGATATTATGAAACATATTAAAGTCGATAAACATTTTATAAACGAGAAGATTGATGCAGGAGTAATATGCATTCCCTACCTTCCGACAACAGAGCAAATTGCAGATGTATTAACTAAAGGTCTTCCTAAGTGGCAATTCAACAAGTTGATTGACAAGCTAACCATGAATGATATCTTCAAACTAGCTTGA ATGCCCATGCGCATTTACTATGATAACAAGGCATCAATCTCCATTGCCCACAATCCAGTCCTTCATGATATTATGAAACATATTAAAGTCGATAAACATTTTATAAACGAGAAGATTGATGCAGGAGTAATATGCATTCCCTACCTTCCGACAACAGAGCAAATTGCAGATGTATTAACTAAAGGTCTTCCTAAGTGGCAATTCAACAAGTTGATTGACAAGCTAACCATGAATGATATCTTCAAACTAGCTTGA ATGCCCATGCGCATTTACTATGATAACAAGGCATCAATCTCCATTGCCCACAATCCAGTCCTTCATGATATTATGAAACATATTAAAGTCGATAAACATTTTATAAACGAGAAGATTGATGCAGGAGTAATATGCATTCCCTACCTTCCGACAACAGAGCAAATTGCAGATGTATTAACTAAAGGTCTTCCTAAGTGGCAATTCAACAAGTTGATTGACAAGCTAACCATGAATGATATCTTCAAACTAGCTTGA MPMRIYYDNKASISIAHNPVLHDIMKHIKVDKHFINEKIDAGVICIPYLPTTEQIADVLTKGLPKWQFNKLIDKLTMNDIFKLA Homology
BLAST of CmUC09G174780 vs. NCBI nr
Match: KAA0061370.1 (putative mitochondrial protein [Cucumis melo var. makuwa] >TYK14725.1 putative mitochondrial protein [Cucumis melo var. makuwa]) HSP 1 Score: 131.0 bits (328), Expect = 5.0e-27 Identity = 63/82 (76.83%), Postives = 69/82 (84.15%), Query Frame = 0
BLAST of CmUC09G174780 vs. NCBI nr
Match: RVW80855.1 (Retrovirus-related Pol polyprotein from transposon RE1 [Vitis vinifera]) HSP 1 Score: 126.7 bits (317), Expect = 9.3e-26 Identity = 55/84 (65.48%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CmUC09G174780 vs. NCBI nr
Match: CAN61703.1 (hypothetical protein VITISV_026977 [Vitis vinifera]) HSP 1 Score: 125.2 bits (313), Expect = 2.7e-25 Identity = 53/84 (63.10%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CmUC09G174780 vs. NCBI nr
Match: XP_040996179.1 (uncharacterized protein LOC121242374 [Juglans microcarpa x Juglans regia]) HSP 1 Score: 125.2 bits (313), Expect = 2.7e-25 Identity = 57/84 (67.86%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CmUC09G174780 vs. NCBI nr
Match: RVX09086.1 (Retrovirus-related Pol polyprotein from transposon RE1 [Vitis vinifera]) HSP 1 Score: 124.8 bits (312), Expect = 3.6e-25 Identity = 55/83 (66.27%), Postives = 68/83 (81.93%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 79.0 bits (193), Expect = 2.9e-14 Identity = 36/74 (48.65%), Postives = 49/74 (66.22%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.8e-09 Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-08 Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.6e-04 Identity = 22/64 (34.38%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy TrEMBL
Match: A0A5D3CT98 (Putative mitochondrial protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold692G00570 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.4e-27 Identity = 63/82 (76.83%), Postives = 69/82 (84.15%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy TrEMBL
Match: A0A2N9EE05 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS847 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.7e-26 Identity = 58/84 (69.05%), Postives = 72/84 (85.71%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy TrEMBL
Match: A0A2N9G304 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS21755 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.7e-26 Identity = 57/84 (67.86%), Postives = 72/84 (85.71%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy TrEMBL
Match: A0A438H8N5 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Vitis vinifera OX=29760 GN=RE1_2982 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 4.5e-26 Identity = 55/84 (65.48%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CmUC09G174780 vs. ExPASy TrEMBL
Match: A0A1S8ACK5 (Cysteine-rich RLK RECEPTOR-like protein kinase OS=Citrus limon OX=2708 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 7.7e-26 Identity = 57/84 (67.86%), Postives = 70/84 (83.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|