CmUC09G173030 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTACCATCGTAAGTTTATCTTCTTGTAATATTTTGGTTGAGTTCATCTTCCTTTTTAAATATACTTTTAATCTTAACTACTTAACAAATTCTTTTTTTTTTTTTTTTCTTCTTCTTTTTCTGCATATGTTGGAGAAAAGTGAAATCGTGGCCTGCACTGATCTTCATAAATGCAGACACAGTTGCAAATATCATCAAGAAAGAACATCCTGACTTTCATATGATCAAAGTGCTGGCAGGAACTCCAGTAACAAAGGATCTTAAACATGGTCGAGTTCGATTAGTTACAAATGTAGAGGAAATTGTGGTTGAAATTCCTCAAGAGGGCTAA ATGTCTTACCATCTGAAATCGTGGCCTGCACTGATCTTCATAAATGCAGACACAGTTGCAAATATCATCAAGAAAGAACATCCTGACTTTCATATGATCAAAGTGCTGGCAGGAACTCCAGTAACAAAGGATCTTAAACATGGTCGAGTTCGATTAGTTACAAATGTAGAGGAAATTGTGGTTGAAATTCCTCAAGAGGGCTAA ATGTCTTACCATCTGAAATCGTGGCCTGCACTGATCTTCATAAATGCAGACACAGTTGCAAATATCATCAAGAAAGAACATCCTGACTTTCATATGATCAAAGTGCTGGCAGGAACTCCAGTAACAAAGGATCTTAAACATGGTCGAGTTCGATTAGTTACAAATGTAGAGGAAATTGTGGTTGAAATTCCTCAAGAGGGCTAA MSYHLKSWPALIFINADTVANIIKKEHPDFHMIKVLAGTPVTKDLKHGRVRLVTNVEEIVVEIPQEG Homology
BLAST of CmUC09G173030 vs. NCBI nr
Match: KGN60477.1 (hypothetical protein Csa_001998 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 5.7e-18 Identity = 48/65 (73.85%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of CmUC09G173030 vs. NCBI nr
Match: KAG6571807.1 (hypothetical protein SDJN03_28535, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 93.2 bits (230), Expect = 9.1e-16 Identity = 43/67 (64.18%), Postives = 54/67 (80.60%), Query Frame = 0
BLAST of CmUC09G173030 vs. NCBI nr
Match: KGN60478.1 (hypothetical protein Csa_001396 [Cucumis sativus]) HSP 1 Score: 80.1 bits (196), Expect = 8.0e-12 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of CmUC09G173030 vs. NCBI nr
Match: XP_011654473.1 (inhibitor of trypsin and hageman factor [Cucumis sativus] >KGN49621.1 hypothetical protein Csa_018430 [Cucumis sativus]) HSP 1 Score: 62.0 bits (149), Expect = 2.3e-06 Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of CmUC09G173030 vs. NCBI nr
Match: XP_006442409.1 (inhibitor of trypsin and hageman factor [Citrus clementina] >ESR55649.1 hypothetical protein CICLE_v10022906mg [Citrus clementina]) HSP 1 Score: 61.6 bits (148), Expect = 2.9e-06 Identity = 28/61 (45.90%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy Swiss-Prot
Match: Q03199 (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-06 Identity = 29/61 (47.54%), Postives = 38/61 (62.30%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 5.2e-06 Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-05 Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 2.0e-05 Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.4e-05 Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy TrEMBL
Match: A0A0A0LIF6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914570 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 2.8e-18 Identity = 48/65 (73.85%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy TrEMBL
Match: A0A0A0LFD4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914580 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 3.9e-12 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy TrEMBL
Match: A0A0A0KPI0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G027950 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.1e-06 Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy TrEMBL
Match: V4VRJ6 (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10022906mg PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.4e-06 Identity = 28/61 (45.90%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of CmUC09G173030 vs. ExPASy TrEMBL
Match: A0A2H5N3H1 (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_282610 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.4e-06 Identity = 28/61 (45.90%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of CmUC09G173030 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 50.4 bits (119), Expect = 6.3e-07 Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|