CmUC06G113120 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGGCGTTTGGGTGTTCAAAAACGGTGTCGTCCGGCTGGTGGAGAACGGCGGAGCCGATACGGCAGAGGGCGGTCAGCGGTCGAGACTTCGGCGGAAAGTGTTGGTGTTCAGTTCGACGGCGGAGGTGATTACGTCATACGCAATGTTGGAAGAGAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGTTGCAATTCCACAAGAGATCAACGGTCCATCTTATTTCTCTCCCAAAAGACTTTGCCAAATTCAAATCCATGCGTATGTATGACATCGTCGTCAAGAATCGAAATAATTTCGAAGTTAGAGATGCCTAA ATGGCGGGCGTTTGGGTGTTCAAAAACGGTGTCGTCCGGCTGGTGGAGAACGGCGGAGCCGATACGGCAGAGGGCGGTCAGCGGTCGAGACTTCGGCGGAAAGTGTTGGTGTTCAGTTCGACGGCGGAGGTGATTACGTCATACGCAATGTTGGAAGAGAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGTTGCAATTCCACAAGAGATCAACGGTCCATCTTATTTCTCTCCCAAAAGACTTTGCCAAATTCAAATCCATGCGTATGTATGACATCGTCGTCAAGAATCGAAATAATTTCGAAGTTAGAGATGCCTAA ATGGCGGGCGTTTGGGTGTTCAAAAACGGTGTCGTCCGGCTGGTGGAGAACGGCGGAGCCGATACGGCAGAGGGCGGTCAGCGGTCGAGACTTCGGCGGAAAGTGTTGGTGTTCAGTTCGACGGCGGAGGTGATTACGTCATACGCAATGTTGGAAGAGAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGTTGCAATTCCACAAGAGATCAACGGTCCATCTTATTTCTCTCCCAAAAGACTTTGCCAAATTCAAATCCATGCGTATGTATGACATCGTCGTCAAGAATCGAAATAATTTCGAAGTTAGAGATGCCTAA MAGVWVFKNGVVRLVENGGADTAEGGQRSRLRRKVLVFSSTAEVITSYAMLEEKLMTLGWERYYDDPNLLQFHKRSTVHLISLPKDFAKFKSMRMYDIVVKNRNNFEVRDA Homology
BLAST of CmUC06G113120 vs. NCBI nr
Match: XP_022959407.1 (flowering-promoting factor 1-like protein 3 [Cucurbita moschata] >KAG6575061.1 Flowering-promoting factor 1-like protein 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 204.1 bits (518), Expect = 6.1e-49 Identity = 99/110 (90.00%), Postives = 105/110 (95.45%), Query Frame = 0
BLAST of CmUC06G113120 vs. NCBI nr
Match: XP_023006452.1 (flowering-promoting factor 1-like protein 3 [Cucurbita maxima] >XP_023549095.1 flowering-promoting factor 1-like protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 203.0 bits (515), Expect = 1.4e-48 Identity = 99/110 (90.00%), Postives = 105/110 (95.45%), Query Frame = 0
BLAST of CmUC06G113120 vs. NCBI nr
Match: KAG7013634.1 (Flowering-promoting factor 1-like protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 202.6 bits (514), Expect = 1.8e-48 Identity = 98/110 (89.09%), Postives = 105/110 (95.45%), Query Frame = 0
BLAST of CmUC06G113120 vs. NCBI nr
Match: XP_008458459.1 (PREDICTED: flowering-promoting factor 1-like protein 1 [Cucumis melo]) HSP 1 Score: 189.5 bits (480), Expect = 1.6e-44 Identity = 91/110 (82.73%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of CmUC06G113120 vs. NCBI nr
Match: KAG7026306.1 (Flowering-promoting factor 1-like protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 188.3 bits (477), Expect = 3.5e-44 Identity = 91/111 (81.98%), Postives = 100/111 (90.09%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy Swiss-Prot
Match: Q0E1D7 (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.2e-32 Identity = 71/113 (62.83%), Postives = 86/113 (76.11%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.3e-30 Identity = 69/113 (61.06%), Postives = 85/113 (75.22%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.9e-30 Identity = 67/113 (59.29%), Postives = 86/113 (76.11%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy Swiss-Prot
Match: Q9LGE3 (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 6.6e-30 Identity = 68/113 (60.18%), Postives = 83/113 (73.45%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 128.3 bits (321), Expect = 5.6e-29 Identity = 70/123 (56.91%), Postives = 88/123 (71.54%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy TrEMBL
Match: A0A6J1H4F8 (flowering-promoting factor 1-like protein 3 OS=Cucurbita moschata OX=3662 GN=LOC111460392 PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 2.9e-49 Identity = 99/110 (90.00%), Postives = 105/110 (95.45%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy TrEMBL
Match: A0A6J1KVW8 (flowering-promoting factor 1-like protein 3 OS=Cucurbita maxima OX=3661 GN=LOC111499175 PE=3 SV=1) HSP 1 Score: 203.0 bits (515), Expect = 6.6e-49 Identity = 99/110 (90.00%), Postives = 105/110 (95.45%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy TrEMBL
Match: A0A1S3C8H5 (flowering-promoting factor 1-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103497861 PE=3 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 7.5e-45 Identity = 91/110 (82.73%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy TrEMBL
Match: A0A0A0KCC2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194670 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 2.2e-44 Identity = 93/111 (83.78%), Postives = 101/111 (90.99%), Query Frame = 0
BLAST of CmUC06G113120 vs. ExPASy TrEMBL
Match: A0A6J1ER18 (flowering-promoting factor 1-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111436916 PE=3 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 1.1e-43 Identity = 89/111 (80.18%), Postives = 99/111 (89.19%), Query Frame = 0
BLAST of CmUC06G113120 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 132.5 bits (332), Expect = 2.1e-31 Identity = 67/113 (59.29%), Postives = 86/113 (76.11%), Query Frame = 0
BLAST of CmUC06G113120 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 128.3 bits (321), Expect = 4.0e-30 Identity = 70/123 (56.91%), Postives = 88/123 (71.54%), Query Frame = 0
BLAST of CmUC06G113120 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 127.9 bits (320), Expect = 5.2e-30 Identity = 66/115 (57.39%), Postives = 84/115 (73.04%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|