CmUC03G059900 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTAACAGATCCCTCCTATAATCCTGTTGCTTCCACTGTAGAGATTGAAGCTGAATTTTTACTTTTTACACCATTATTAGCTTATTTGCCTAAGGAGGAACTTGAAGATCAGGTTTTTGATATTCTTTCCTTGTGGATCCCGTTTTTTGCTTGTGAGGAGAGCAGTGGAATGATGTCCCTTCTTGGAGTTGTGGAGCAGTGTTTGAAAACTGGAAAGAAACAGCCACGGAATGATGCTGTCACTAGGGGGATGATTGTTGGTTTAAGGCACTTTAAATCATGA ATGCTAACAGATCCCTCCTATAATCCTGTTGCTTCCACTGTAGAGATTGAAGCTGAATTTTTACTTTTTACACCATTATTAGCTTATTTGCCTAAGGAGGAACTTGAAGATCAGGTTTTTGATATTCTTTCCTTGTGGATCCCGTTTTTTGCTTGTGAGGAGAGCAGTGGAATGATGTCCCTTCTTGGAGTTGTGGAGCAGTGTTTGAAAACTGGAAAGAAACAGCCACGGAATGATGCTGTCACTAGGGGGATGATTGTTGGTTTAAGGCACTTTAAATCATGA ATGCTAACAGATCCCTCCTATAATCCTGTTGCTTCCACTGTAGAGATTGAAGCTGAATTTTTACTTTTTACACCATTATTAGCTTATTTGCCTAAGGAGGAACTTGAAGATCAGGTTTTTGATATTCTTTCCTTGTGGATCCCGTTTTTTGCTTGTGAGGAGAGCAGTGGAATGATGTCCCTTCTTGGAGTTGTGGAGCAGTGTTTGAAAACTGGAAAGAAACAGCCACGGAATGATGCTGTCACTAGGGGGATGATTGTTGGTTTAAGGCACTTTAAATCATGA MLTDPSYNPVASTVEIEAEFLLFTPLLAYLPKEELEDQVFDILSLWIPFFACEESSGMMSLLGVVEQCLKTGKKQPRNDAVTRGMIVGLRHFKS Homology
BLAST of CmUC03G059900 vs. NCBI nr
Match: XP_022134267.1 (protein SWEETIE [Momordica charantia]) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-10 Identity = 40/50 (80.00%), Postives = 42/50 (84.00%), Query Frame = 0
BLAST of CmUC03G059900 vs. NCBI nr
Match: XP_008459470.1 (PREDICTED: HEAT repeat-containing protein 5B isoform X2 [Cucumis melo]) HSP 1 Score: 75.5 bits (184), Expect = 2.8e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. NCBI nr
Match: XP_008459470.1 (PREDICTED: HEAT repeat-containing protein 5B isoform X2 [Cucumis melo]) HSP 1 Score: 60.5 bits (145), Expect = 9.2e-06 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0
HSP 2 Score: 75.5 bits (184), Expect = 2.8e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. NCBI nr
Match: XP_011656034.1 (protein SWEETIE [Cucumis sativus] >KAE8648964.1 hypothetical protein Csa_007912 [Cucumis sativus]) HSP 1 Score: 60.5 bits (145), Expect = 9.2e-06 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0
HSP 2 Score: 75.5 bits (184), Expect = 2.8e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. NCBI nr
Match: KAA0039373.1 (HEAT repeat-containing protein 5B isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 60.5 bits (145), Expect = 9.2e-06 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0
HSP 2 Score: 75.5 bits (184), Expect = 2.8e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. ExPASy Swiss-Prot
Match: F4HRS2 (Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2) HSP 1 Score: 45.4 bits (106), Expect = 4.0e-04 Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 0
HSP 2 Score: 45.1 bits (105), Expect = 5.2e-04 Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 0
BLAST of CmUC03G059900 vs. ExPASy TrEMBL
Match: A0A6J1BZ65 (protein SWEETIE OS=Momordica charantia OX=3673 GN=LOC111006570 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 6.0e-11 Identity = 40/50 (80.00%), Postives = 42/50 (84.00%), Query Frame = 0
BLAST of CmUC03G059900 vs. ExPASy TrEMBL
Match: A0A5A7T8T6 (HEAT repeat-containing protein 5B isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold64G001750 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.3e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. ExPASy TrEMBL
Match: A0A5A7T8T6 (HEAT repeat-containing protein 5B isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold64G001750 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 4.5e-06 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0
HSP 2 Score: 75.5 bits (184), Expect = 1.3e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. ExPASy TrEMBL
Match: A0A5D3BL71 (HEAT repeat-containing protein 5B isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold169G001760 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 4.5e-06 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0
HSP 2 Score: 75.5 bits (184), Expect = 1.3e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. ExPASy TrEMBL
Match: A0A1S3CAC7 (HEAT repeat-containing protein 5B isoform X2 OS=Cucumis melo OX=3656 GN=LOC103498597 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 4.5e-06 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0
HSP 2 Score: 75.5 bits (184), Expect = 1.3e-10 Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of CmUC03G059900 vs. TAIR 10
Match: AT1G67140.1 (HEAT repeat-containing protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.9e-05 Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 0
HSP 2 Score: 45.1 bits (105), Expect = 3.7e-05 Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 0
BLAST of CmUC03G059900 vs. TAIR 10
Match: AT1G67140.3 (HEAT repeat-containing protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.9e-05 Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 0
HSP 2 Score: 45.1 bits (105), Expect = 3.7e-05 Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 0
BLAST of CmUC03G059900 vs. TAIR 10
Match: AT1G67140.2 (HEAT repeat-containing protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.9e-05 Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 0
HSP 2 Score: 45.1 bits (105), Expect = 3.7e-05 Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
Pages
Pages
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|