
CmUC03G059540 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAATGGGAGTTGTCTCTGGTGGGTTTAAGGGACAGAAACAGAGGGGTTTGATGGTCCATGCCTTACCTTGTGTATTGCTATAAGAACCCTTTCTTTCCCACAATCTCTCTTCAAAACAAATACAAAGCAATAATCTCCCATTTCCAAAACTCATCCAAAGCAGCAAATTGCAATTAAAATGAAGATGATGATGATGTCCAGCAGTGGAAGCTCCAAGAGAAGGCTTTCATCTCCAACTAGAGGATTTGGAGGAGTTGTTAGAGAGCAAAGGGCAAAGCTTTACATTATTAGAAGATGTGTTGTTATGCTTCTTTGTTGGCATGATTAA ATGAAAATGGGAGTTGTCTCTGGTGGGTTTAAGGGACAGAAACAGAGGGGTTTGATGGTCCATGCCTTACCTTGTCAGCAAATTGCAATTAAAATGAAGATGATGATGATGTCCAGCAGTGGAAGCTCCAAGAGAAGGCTTTCATCTCCAACTAGAGGATTTGGAGGAGTTGTTAGAGAGCAAAGGGCAAAGCTTTACATTATTAGAAGATGTGTTGTTATGCTTCTTTGTTGGCATGATTAA ATGAAAATGGGAGTTGTCTCTGGTGGGTTTAAGGGACAGAAACAGAGGGGTTTGATGGTCCATGCCTTACCTTGTCAGCAAATTGCAATTAAAATGAAGATGATGATGATGTCCAGCAGTGGAAGCTCCAAGAGAAGGCTTTCATCTCCAACTAGAGGATTTGGAGGAGTTGTTAGAGAGCAAAGGGCAAAGCTTTACATTATTAGAAGATGTGTTGTTATGCTTCTTTGTTGGCATGATTAA MKMGVVSGGFKGQKQRGLMVHALPCQQIAIKMKMMMMSSSGSSKRRLSSPTRGFGGVVREQRAKLYIIRRCVVMLLCWHD Homology
BLAST of CmUC03G059540 vs. NCBI nr
Match: XP_016899479.1 (PREDICTED: uncharacterized protein LOC103485763 [Cucumis melo] >XP_016899480.1 PREDICTED: uncharacterized protein LOC103485763 [Cucumis melo]) HSP 1 Score: 92.8 bits (229), Expect = 1.4e-15 Identity = 47/50 (94.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of CmUC03G059540 vs. NCBI nr
Match: XP_038875556.1 (uncharacterized protein LOC120067970 [Benincasa hispida]) HSP 1 Score: 91.7 bits (226), Expect = 3.2e-15 Identity = 43/46 (93.48%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of CmUC03G059540 vs. NCBI nr
Match: XP_004138925.1 (uncharacterized protein LOC101205568 [Cucumis sativus]) HSP 1 Score: 89.0 bits (219), Expect = 2.1e-14 Identity = 45/50 (90.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of CmUC03G059540 vs. NCBI nr
Match: XP_022930103.1 (uncharacterized protein LOC111436587 [Cucurbita moschata] >XP_023552920.1 uncharacterized protein LOC111810443 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 85.5 bits (210), Expect = 2.3e-13 Identity = 39/46 (84.78%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of CmUC03G059540 vs. NCBI nr
Match: XP_022973613.1 (uncharacterized protein LOC111472196 [Cucurbita maxima]) HSP 1 Score: 83.6 bits (205), Expect = 8.6e-13 Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy Swiss-Prot
Match: Q6X5T8 (Small polypeptide DEVIL 5 OS=Arabidopsis thaliana OX=3702 GN=DVL5 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.4e-10 Identity = 33/43 (76.74%), Postives = 37/43 (86.05%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy Swiss-Prot
Match: Q9SAF8 (Small polypeptide DEVIL 4 OS=Arabidopsis thaliana OX=3702 GN=DVL4 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.4e-10 Identity = 31/40 (77.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy Swiss-Prot
Match: Q6IM95 (Small polypeptide DEVIL 6 OS=Arabidopsis thaliana OX=3702 GN=DVL6 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.6e-09 Identity = 31/40 (77.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy Swiss-Prot
Match: Q6X5V0 (Small polypeptide DEVIL 1 OS=Arabidopsis thaliana OX=3702 GN=DVL1 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.6e-07 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy Swiss-Prot
Match: Q6X5U0 (Small polypeptide DEVIL 3 OS=Arabidopsis thaliana OX=3702 GN=DVL3 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 19/26 (73.08%), Postives = 24/26 (92.31%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy TrEMBL
Match: A0A1S4DU14 (uncharacterized protein LOC103485763 OS=Cucumis melo OX=3656 GN=LOC103485763 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 6.9e-16 Identity = 47/50 (94.00%), Postives = 49/50 (98.00%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy TrEMBL
Match: A0A6J1EU31 (uncharacterized protein LOC111436587 OS=Cucurbita moschata OX=3662 GN=LOC111436587 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 1.1e-13 Identity = 39/46 (84.78%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy TrEMBL
Match: A0A6J1IDN2 (uncharacterized protein LOC111472196 OS=Cucurbita maxima OX=3661 GN=LOC111472196 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 4.2e-13 Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy TrEMBL
Match: A0A6J1E3C6 (uncharacterized protein LOC111025664 OS=Momordica charantia OX=3673 GN=LOC111025664 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 7.1e-13 Identity = 41/47 (87.23%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of CmUC03G059540 vs. ExPASy TrEMBL
Match: A0A6B9VB24 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=DS421_19g664060 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 2.3e-11 Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmUC03G059540 vs. TAIR 10
Match: AT1G68825.1 (ROTUNDIFOLIA like 15 ) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-11 Identity = 33/43 (76.74%), Postives = 37/43 (86.05%), Query Frame = 0
BLAST of CmUC03G059540 vs. TAIR 10
Match: AT1G68825.2 (ROTUNDIFOLIA like 15 ) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-11 Identity = 33/43 (76.74%), Postives = 37/43 (86.05%), Query Frame = 0
BLAST of CmUC03G059540 vs. TAIR 10
Match: AT1G13245.1 (ROTUNDIFOLIA like 17 ) HSP 1 Score: 64.7 bits (156), Expect = 3.9e-11 Identity = 31/40 (77.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of CmUC03G059540 vs. TAIR 10
Match: AT3G25717.1 (ROTUNDIFOLIA like 16 ) HSP 1 Score: 63.2 bits (152), Expect = 1.1e-10 Identity = 31/40 (77.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of CmUC03G059540 vs. TAIR 10
Match: AT5G16023.1 (ROTUNDIFOLIA like 18 ) HSP 1 Score: 53.9 bits (128), Expect = 6.8e-08 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|