CmUC02G030550 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA MGFRLPSIVHAKQSFRRSSSTGNGASPKAIDVPKDYFAVYVGEAQKKRFVIPLSCLNQPSFQDLLSQAEEEFGYDHPMGGITIPCSEETFLSLMQS Homology
BLAST of CmUC02G030550 vs. NCBI nr
Match: XP_038887257.1 (auxin-induced protein 15A-like [Benincasa hispida]) HSP 1 Score: 189.5 bits (480), Expect = 1.3e-44 Identity = 91/96 (94.79%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of CmUC02G030550 vs. NCBI nr
Match: KAG6572081.1 (hypothetical protein SDJN03_28809, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 185.7 bits (470), Expect = 1.9e-43 Identity = 89/96 (92.71%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of CmUC02G030550 vs. NCBI nr
Match: XP_022135743.1 (auxin-induced protein 15A-like [Momordica charantia]) HSP 1 Score: 179.1 bits (453), Expect = 1.8e-41 Identity = 85/96 (88.54%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of CmUC02G030550 vs. NCBI nr
Match: XP_022989148.1 (auxin-induced protein 15A-like [Cucurbita maxima]) HSP 1 Score: 177.6 bits (449), Expect = 5.3e-41 Identity = 84/96 (87.50%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CmUC02G030550 vs. NCBI nr
Match: KAG6588983.1 (hypothetical protein SDJN03_17548, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 176.4 bits (446), Expect = 1.2e-40 Identity = 83/96 (86.46%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy Swiss-Prot
Match: P32295 (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.2e-26 Identity = 61/90 (67.78%), Postives = 67/90 (74.44%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.9e-26 Identity = 57/93 (61.29%), Postives = 72/93 (77.42%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy Swiss-Prot
Match: P33083 (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.9e-25 Identity = 59/90 (65.56%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy Swiss-Prot
Match: P33079 (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 9.4e-25 Identity = 57/93 (61.29%), Postives = 70/93 (75.27%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy Swiss-Prot
Match: P33081 (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-24 Identity = 60/90 (66.67%), Postives = 66/90 (73.33%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy TrEMBL
Match: A0A6J1C5R3 (auxin-induced protein 15A-like OS=Momordica charantia OX=3673 GN=LOC111007633 PE=3 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 8.8e-42 Identity = 85/96 (88.54%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy TrEMBL
Match: A0A6J1JPE8 (auxin-induced protein 15A-like OS=Cucurbita maxima OX=3661 GN=LOC111486306 PE=3 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.6e-41 Identity = 84/96 (87.50%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy TrEMBL
Match: A0A6J1C3L5 (indole-3-acetic acid-induced protein ARG7-like OS=Momordica charantia OX=3673 GN=LOC111007632 PE=3 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 5.7e-41 Identity = 82/95 (86.32%), Postives = 88/95 (92.63%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy TrEMBL
Match: A0A6J1JPF3 (auxin-induced protein 15A-like OS=Cucurbita maxima OX=3661 GN=LOC111486310 PE=3 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 7.4e-41 Identity = 80/96 (83.33%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CmUC02G030550 vs. ExPASy TrEMBL
Match: A0A0A0K2F0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008460 PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.1e-39 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of CmUC02G030550 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 119.4 bits (298), Expect = 1.6e-27 Identity = 54/94 (57.45%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CmUC02G030550 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 3.7e-24 Identity = 49/87 (56.32%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of CmUC02G030550 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 106.7 bits (265), Expect = 1.1e-23 Identity = 48/87 (55.17%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of CmUC02G030550 vs. TAIR 10
Match: AT2G21200.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 3.1e-23 Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of CmUC02G030550 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 3.1e-23 Identity = 48/87 (55.17%), Postives = 68/87 (78.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|