CmUC01G014600 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTCGAGATAGTCGCCCCGGGACAAAACGATGCCTTGCTCCAAAACCGGTGCGAGCCAGGCGGTTGGGAACCGATCGAGAACATCCACGACTCGTACGTGCAAGAGATAGGAAGGTTTGCAGTGATGGAACACACACACAAGCTAGTAGGAGCATCACTGAGGTTCATTCGTGTGGTGAGTGGTGAGACTAGGCCGATGAGCGAAGGCAAAGAATACAGGCTTGTGGTGGAAGTGGCAGAACAGATAATAACTAGTCCTCCAATGTTATCAGTTTCTATCAAGTTTTACTTGGCAACTGTTCTGGAGAAGCCATTAGATCGATCTTGGACACTCAAAGCTTTTGTGCCTTGTAATTAG ATGGAATTCGAGATAGTCGCCCCGGGACAAAACGATGCCTTGCTCCAAAACCGGTGCGAGCCAGGCGGTTGGGAACCGATCGAGAACATCCACGACTCGTACGTGCAAGAGATAGGAAGGTTTGCAGTGATGGAACACACACACAAGCTAGTAGGAGCATCACTGAGGTTCATTCGTGTGGTGAGTGGTGAGACTAGGCCGATGAGCGAAGGCAAAGAATACAGGCTTGTGGTGGAAGTGGCAGAACAGATAATAACTAGTCCTCCAATGTTATCAGTTTCTATCAAGTTTTACTTGGCAACTGTTCTGGAGAAGCCATTAGATCGATCTTGGACACTCAAAGCTTTTGTGCCTTGTAATTAG ATGGAATTCGAGATAGTCGCCCCGGGACAAAACGATGCCTTGCTCCAAAACCGGTGCGAGCCAGGCGGTTGGGAACCGATCGAGAACATCCACGACTCGTACGTGCAAGAGATAGGAAGGTTTGCAGTGATGGAACACACACACAAGCTAGTAGGAGCATCACTGAGGTTCATTCGTGTGGTGAGTGGTGAGACTAGGCCGATGAGCGAAGGCAAAGAATACAGGCTTGTGGTGGAAGTGGCAGAACAGATAATAACTAGTCCTCCAATGTTATCAGTTTCTATCAAGTTTTACTTGGCAACTGTTCTGGAGAAGCCATTAGATCGATCTTGGACACTCAAAGCTTTTGTGCCTTGTAATTAG MEFEIVAPGQNDALLQNRCEPGGWEPIENIHDSYVQEIGRFAVMEHTHKLVGASLRFIRVVSGETRPMSEGKEYRLVVEVAEQIITSPPMLSVSIKFYLATVLEKPLDRSWTLKAFVPCN Homology
BLAST of CmUC01G014600 vs. NCBI nr
Match: WP_198843152.1 (hypothetical protein, partial [Aureibaculum sp. A20] >MBJ2176574.1 hypothetical protein [Aureibaculum sp. A20]) HSP 1 Score: 222.6 bits (566), Expect = 1.8e-54 Identity = 103/120 (85.83%), Postives = 114/120 (95.00%), Query Frame = 0
BLAST of CmUC01G014600 vs. NCBI nr
Match: XP_038882290.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 217.2 bits (552), Expect = 7.5e-53 Identity = 104/120 (86.67%), Postives = 113/120 (94.17%), Query Frame = 0
BLAST of CmUC01G014600 vs. NCBI nr
Match: WP_156424223.1 (hypothetical protein, partial [Myroides odoratus]) HSP 1 Score: 204.5 bits (519), Expect = 5.0e-49 Identity = 95/108 (87.96%), Postives = 104/108 (96.30%), Query Frame = 0
BLAST of CmUC01G014600 vs. NCBI nr
Match: XP_022132557.1 (cysteine proteinase inhibitor 6-like [Momordica charantia]) HSP 1 Score: 130.6 bits (327), Expect = 9.2e-27 Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 0
BLAST of CmUC01G014600 vs. NCBI nr
Match: KAG6604292.1 (putative cysteine proteinase inhibitor 7, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 121.3 bits (303), Expect = 5.6e-24 Identity = 64/118 (54.24%), Postives = 83/118 (70.34%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 2.0e-08 Identity = 42/99 (42.42%), Postives = 53/99 (53.54%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.5e-07 Identity = 37/97 (38.14%), Postives = 52/97 (53.61%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 8.5e-07 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 6.1e-05 Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy TrEMBL
Match: A0A6J1BU61 (cysteine proteinase inhibitor 6-like OS=Momordica charantia OX=3673 GN=LOC111005388 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 4.5e-27 Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy TrEMBL
Match: A0A6J1BX23 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111005501 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 6.7e-23 Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy TrEMBL
Match: A0A6J1BUK6 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111005500 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 8.7e-23 Identity = 68/122 (55.74%), Postives = 85/122 (69.67%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy TrEMBL
Match: A0A6J1GCT2 (uncharacterized protein LOC111453027 OS=Cucurbita moschata OX=3662 GN=LOC111453027 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 8.7e-23 Identity = 62/118 (52.54%), Postives = 81/118 (68.64%), Query Frame = 0
BLAST of CmUC01G014600 vs. ExPASy TrEMBL
Match: A0A6J1FCN5 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111442890 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 5.5e-17 Identity = 51/114 (44.74%), Postives = 74/114 (64.91%), Query Frame = 0
BLAST of CmUC01G014600 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-09 Identity = 42/99 (42.42%), Postives = 53/99 (53.54%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|