CmUC01G010480 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTAGGTCTCTCTTTTTCGTTGCTTCTCTTCTCCTTTTTGTGTCAATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA ATGACTAGGTCTCTCTTTTTCGTTGCTTCTCTTCTCCTTTTTGTGTCAATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA ATGACTAGGTCTCTCTTTTTCGTTGCTTCTCTTCTCCTTTTTGTGTCAATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA MTRSLFFVASLLLFVSMLLITVTSSQLDLVGGYEPIKNIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVAGTNYNLQLTALEGIVSKTYGTLVFTDLKNENHLINFYDLSN Homology
BLAST of CmUC01G010480 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 181.0 bits (458), Expect = 5.9e-42 Identity = 94/119 (78.99%), Postives = 105/119 (88.24%), Query Frame = 0
BLAST of CmUC01G010480 vs. NCBI nr
Match: XP_038895826.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 173.3 bits (438), Expect = 1.2e-39 Identity = 90/114 (78.95%), Postives = 102/114 (89.47%), Query Frame = 0
BLAST of CmUC01G010480 vs. NCBI nr
Match: XP_004151251.1 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 169.1 bits (427), Expect = 2.3e-38 Identity = 89/119 (74.79%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of CmUC01G010480 vs. NCBI nr
Match: KAE8652869.1 (hypothetical protein Csa_013019 [Cucumis sativus]) HSP 1 Score: 169.1 bits (427), Expect = 2.3e-38 Identity = 89/119 (74.79%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of CmUC01G010480 vs. NCBI nr
Match: XP_022927105.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 168.7 bits (426), Expect = 3.0e-38 Identity = 90/118 (76.27%), Postives = 102/118 (86.44%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-14 Identity = 45/102 (44.12%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.9e-12 Identity = 38/94 (40.43%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 72.4 bits (176), Expect = 3.9e-12 Identity = 35/91 (38.46%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.9e-12 Identity = 41/100 (41.00%), Postives = 62/100 (62.00%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 1.1e-38 Identity = 89/119 (74.79%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.5e-38 Identity = 90/118 (76.27%), Postives = 102/118 (86.44%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 2.5e-38 Identity = 87/119 (73.11%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy TrEMBL
Match: A0A6J1IIS7 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474432 PE=4 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 3.2e-38 Identity = 85/117 (72.65%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of CmUC01G010480 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 4.2e-38 Identity = 87/119 (73.11%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of CmUC01G010480 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 7.7e-16 Identity = 45/102 (44.12%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of CmUC01G010480 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 3.3e-11 Identity = 32/84 (38.10%), Postives = 56/84 (66.67%), Query Frame = 0
BLAST of CmUC01G010480 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 55.8 bits (133), Expect = 2.7e-08 Identity = 39/106 (36.79%), Postives = 60/106 (56.60%), Query Frame = 0
BLAST of CmUC01G010480 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 55.5 bits (132), Expect = 3.5e-08 Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 0
BLAST of CmUC01G010480 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 55.1 bits (131), Expect = 4.5e-08 Identity = 36/107 (33.64%), Postives = 59/107 (55.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|