CmUC01G010400 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA MNFRSASLFLILLLPLLAAARKGSLLGDWEKIANVKDPHIQEIGEFAVAEYNKQSKGVTIEFKDVVSGEKQVVSGMNYRLVIDAKRGESIGKYQALVWEKPWENFKKLTSFKPAA Homology
BLAST of CmUC01G010400 vs. NCBI nr
Match: XP_038894857.1 (cysteine proteinase inhibitor 1 [Benincasa hispida]) HSP 1 Score: 187.6 bits (475), Expect = 6.1e-44 Identity = 95/117 (81.20%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of CmUC01G010400 vs. NCBI nr
Match: KAE8652870.1 (hypothetical protein Csa_013034 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 2.6e-42 Identity = 89/115 (77.39%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of CmUC01G010400 vs. NCBI nr
Match: XP_011654999.2 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 2.6e-42 Identity = 89/115 (77.39%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of CmUC01G010400 vs. NCBI nr
Match: XP_022973098.1 (cysteine proteinase inhibitor 5-like [Cucurbita maxima] >KAG6583727.1 Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 176.4 bits (446), Expect = 1.4e-40 Identity = 91/117 (77.78%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of CmUC01G010400 vs. NCBI nr
Match: XP_022927193.1 (cysteine proteinase inhibitor 5-like [Cucurbita moschata]) HSP 1 Score: 176.0 bits (445), Expect = 1.8e-40 Identity = 90/117 (76.92%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 111.7 bits (278), Expect = 5.6e-24 Identity = 57/106 (53.77%), Postives = 78/106 (73.58%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 101.7 bits (252), Expect = 5.8e-21 Identity = 52/109 (47.71%), Postives = 73/109 (66.97%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.4e-20 Identity = 51/109 (46.79%), Postives = 72/109 (66.06%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-17 Identity = 55/117 (47.01%), Postives = 71/117 (60.68%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.1e-16 Identity = 46/100 (46.00%), Postives = 60/100 (60.00%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy TrEMBL
Match: A0A0A0LTF5 (Cystatin-like protein OS=Cucumis sativus OX=3659 GN=Csa_1G183580 PE=4 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 1.9e-43 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy TrEMBL
Match: A0A6J1IC35 (cysteine proteinase inhibitor 5-like OS=Cucurbita maxima OX=3661 GN=LOC111471628 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 6.8e-41 Identity = 91/117 (77.78%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy TrEMBL
Match: A0A6J1EKC1 (cysteine proteinase inhibitor 5-like OS=Cucurbita moschata OX=3662 GN=LOC111434113 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 8.9e-41 Identity = 90/117 (76.92%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy TrEMBL
Match: A0A5D3E5M5 (Cysteine proteinase inhibitor 5 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001210 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.7e-39 Identity = 87/118 (73.73%), Postives = 98/118 (83.05%), Query Frame = 0
BLAST of CmUC01G010400 vs. ExPASy TrEMBL
Match: A0A1S3CJR9 (cysteine proteinase inhibitor 5 OS=Cucumis melo OX=3656 GN=LOC103501752 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.7e-39 Identity = 87/118 (73.73%), Postives = 98/118 (83.05%), Query Frame = 0
BLAST of CmUC01G010400 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 111.7 bits (278), Expect = 4.0e-25 Identity = 57/106 (53.77%), Postives = 78/106 (73.58%), Query Frame = 0
BLAST of CmUC01G010400 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-12 Identity = 47/116 (40.52%), Postives = 64/116 (55.17%), Query Frame = 0
BLAST of CmUC01G010400 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-11 Identity = 35/96 (36.46%), Postives = 59/96 (61.46%), Query Frame = 0
BLAST of CmUC01G010400 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 64.3 bits (155), Expect = 7.3e-11 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 0
BLAST of CmUC01G010400 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 64.3 bits (155), Expect = 7.3e-11 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|