![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Clc10G20055 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCAGCATCCAAAGTATTTTGGTGTTTTGCTCAATGTTATGTTCTCTTCTCTACTACAACTTTCTTGGGAGATGCTGCTTGTCTCCATTACACCAAAATTTCAAATTGCTAACGTTTTGTCTCCTGCCTTCTACACCATGTTCAATCTCTTTTCTGGCTTTCTTGTTCCGAATCTGGTAAGTTATGTTTGTTTGTTTTGGGAAAAACAAACAAAAATTTTCTTTGATTTAATGAAAAGAGACTAA ATGGATCAGCATCCAAAGTATTTTGGTGTTTTGCTCAATGTTATGTTCTCTTCTCTACTACAACTTTCTTGGGAGATGCTGCTTGTCTCCATTACACCAAAATTTCAAATTGCTAACGTTTTGTCTCCTGCCTTCTACACCATGTTCAATCTCTTTTCTGGCTTTCTTGTTCCGAATCTGGTAAGTTATGTTTGTTTGTTTTGGGAAAAACAAACAAAAATTTTCTTTGATTTAATGAAAAGAGACTAA ATGGATCAGCATCCAAAGTATTTTGGTGTTTTGCTCAATGTTATGTTCTCTTCTCTACTACAACTTTCTTGGGAGATGCTGCTTGTCTCCATTACACCAAAATTTCAAATTGCTAACGTTTTGTCTCCTGCCTTCTACACCATGTTCAATCTCTTTTCTGGCTTTCTTGTTCCGAATCTGGTAAGTTATGTTTGTTTGTTTTGGGAAAAACAAACAAAAATTTTCTTTGATTTAATGAAAAGAGACTAA MDQHPKYFGVLLNVMFSSLLQLSWEMLLVSITPKFQIANVLSPAFYTMFNLFSGFLVPNLVSYVCLFWEKQTKIFFDLMKRD Homology
BLAST of Clc10G20055 vs. NCBI nr
Match: XP_031741892.1 (pleiotropic drug resistance protein 3 isoform X2 [Cucumis sativus]) HSP 1 Score: 61.6 bits (148), Expect = 3.6e-06 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Clc10G20055 vs. NCBI nr
Match: XP_004140460.1 (pleiotropic drug resistance protein 3 isoform X1 [Cucumis sativus] >KGN50690.2 hypothetical protein Csa_004732 [Cucumis sativus]) HSP 1 Score: 61.6 bits (148), Expect = 3.6e-06 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Clc10G20055 vs. NCBI nr
Match: XP_008456863.1 (PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 3-like [Cucumis melo]) HSP 1 Score: 61.6 bits (148), Expect = 3.6e-06 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Clc10G20055 vs. NCBI nr
Match: XP_023522396.1 (pleiotropic drug resistance protein 3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-05 Identity = 31/53 (58.49%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of Clc10G20055 vs. NCBI nr
Match: XP_023529014.1 (pleiotropic drug resistance protein 3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-05 Identity = 31/53 (58.49%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy Swiss-Prot
Match: Q5W274 (Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum OX=4097 GN=PDR3 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.4e-05 Identity = 25/45 (55.56%), Postives = 35/45 (77.78%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy Swiss-Prot
Match: Q9LFH0 (ABC transporter G family member 37 OS=Arabidopsis thaliana OX=3702 GN=ABCG37 PE=1 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 4.1e-05 Identity = 26/45 (57.78%), Postives = 31/45 (68.89%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy Swiss-Prot
Match: A2WSH0 (ABC transporter G family member 36 OS=Oryza sativa subsp. indica OX=39946 GN=ABCG36 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.1e-05 Identity = 22/53 (41.51%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy Swiss-Prot
Match: Q0JLC5 (ABC transporter G family member 36 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG36 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.1e-05 Identity = 22/53 (41.51%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy Swiss-Prot
Match: Q7FMW4 (ABC transporter G family member 38 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG38 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.1e-05 Identity = 23/53 (43.40%), Postives = 34/53 (64.15%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy TrEMBL
Match: A0A0A0KPP7 (ABC transporter domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G292210 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.7e-06 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy TrEMBL
Match: A0A1S3C5F9 (LOW QUALITY PROTEIN: pleiotropic drug resistance protein 3-like OS=Cucumis melo OX=3656 GN=LOC103496678 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.7e-06 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy TrEMBL
Match: A0A6J1J0E0 (pleiotropic drug resistance protein 3-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111481557 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 5.1e-06 Identity = 31/53 (58.49%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy TrEMBL
Match: A0A6J1IXK1 (pleiotropic drug resistance protein 3-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111481557 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 5.1e-06 Identity = 31/53 (58.49%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of Clc10G20055 vs. ExPASy TrEMBL
Match: A0A5A7UFY6 (Pleiotropic drug resistance protein 3-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G006020 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 6.6e-06 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of Clc10G20055 vs. TAIR 10
Match: AT3G53480.1 (pleiotropic drug resistance 9 ) HSP 1 Score: 48.5 bits (114), Expect = 2.9e-06 Identity = 26/45 (57.78%), Postives = 31/45 (68.89%), Query Frame = 0
BLAST of Clc10G20055 vs. TAIR 10
Match: AT1G59870.1 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 46.2 bits (108), Expect = 1.5e-05 Identity = 23/53 (43.40%), Postives = 34/53 (64.15%), Query Frame = 0
BLAST of Clc10G20055 vs. TAIR 10
Match: AT2G37280.1 (pleiotropic drug resistance 5 ) HSP 1 Score: 45.8 bits (107), Expect = 1.9e-05 Identity = 23/48 (47.92%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of Clc10G20055 vs. TAIR 10
Match: AT1G15210.1 (pleiotropic drug resistance 7 ) HSP 1 Score: 44.7 bits (104), Expect = 4.2e-05 Identity = 21/43 (48.84%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Clc10G20055 vs. TAIR 10
Match: AT1G15520.1 (pleiotropic drug resistance 12 ) HSP 1 Score: 43.9 bits (102), Expect = 7.2e-05 Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|