![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Clc08G07700 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGA ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGA ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGA MSMDLEFPKNLPKIRLPLQVRSPPKPSLSDNIPSSASASASDHDSDIDRRACRTPTSAEHKIPKILSCPGAPKKPKRPPVPCKRKLTMELKFFEIVNQEEVDNFFRSAYDLESSTTAPPKRTCCRSA Homology
BLAST of Clc08G07700 vs. NCBI nr
Match: XP_038884240.1 (cyclin-dependent protein kinase inhibitor SMR1-like [Benincasa hispida]) HSP 1 Score: 232.6 bits (592), Expect = 1.8e-57 Identity = 117/126 (92.86%), Postives = 121/126 (96.03%), Query Frame = 0
BLAST of Clc08G07700 vs. NCBI nr
Match: XP_008456553.1 (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo] >KAA0057132.1 cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo var. makuwa] >TYJ97113.1 cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo var. makuwa]) HSP 1 Score: 226.1 bits (575), Expect = 1.7e-55 Identity = 114/125 (91.20%), Postives = 117/125 (93.60%), Query Frame = 0
BLAST of Clc08G07700 vs. NCBI nr
Match: XP_011649858.1 (cyclin-dependent protein kinase inhibitor SMR1 [Cucumis sativus] >KGN63026.1 hypothetical protein Csa_022022 [Cucumis sativus]) HSP 1 Score: 225.7 bits (574), Expect = 2.2e-55 Identity = 114/125 (91.20%), Postives = 117/125 (93.60%), Query Frame = 0
BLAST of Clc08G07700 vs. NCBI nr
Match: XP_023521119.1 (cyclin-dependent protein kinase inhibitor SMR1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 214.9 bits (546), Expect = 3.9e-52 Identity = 109/128 (85.16%), Postives = 117/128 (91.41%), Query Frame = 0
BLAST of Clc08G07700 vs. NCBI nr
Match: XP_022990487.1 (cyclin-dependent protein kinase inhibitor SMR1-like [Cucurbita maxima]) HSP 1 Score: 213.0 bits (541), Expect = 1.5e-51 Identity = 108/128 (84.38%), Postives = 116/128 (90.62%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy Swiss-Prot
Match: Q9LPP4 (Cyclin-dependent protein kinase inhibitor SMR1 OS=Arabidopsis thaliana OX=3702 GN=SMR1 PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.3e-09 Identity = 51/135 (37.78%), Postives = 68/135 (50.37%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy Swiss-Prot
Match: Q9LZ78 (Cyclin-dependent protein kinase inhibitor SIM OS=Arabidopsis thaliana OX=3702 GN=SIM PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.2e-06 Identity = 39/98 (39.80%), Postives = 54/98 (55.10%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy TrEMBL
Match: A0A5A7UMQ0 (Cyclin-dependent protein kinase inhibitor SMR1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold371G00200 PE=4 SV=1) HSP 1 Score: 226.1 bits (575), Expect = 8.3e-56 Identity = 114/125 (91.20%), Postives = 117/125 (93.60%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy TrEMBL
Match: A0A1S3C3L4 (cyclin-dependent protein kinase inhibitor SMR1-like OS=Cucumis melo OX=3656 GN=LOC103496472 PE=4 SV=1) HSP 1 Score: 226.1 bits (575), Expect = 8.3e-56 Identity = 114/125 (91.20%), Postives = 117/125 (93.60%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy TrEMBL
Match: A0A0A0LSQ6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G384460 PE=4 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 1.1e-55 Identity = 114/125 (91.20%), Postives = 117/125 (93.60%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy TrEMBL
Match: A0A6J1JIW3 (cyclin-dependent protein kinase inhibitor SMR1-like OS=Cucurbita maxima OX=3661 GN=LOC111487335 PE=4 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 7.3e-52 Identity = 108/128 (84.38%), Postives = 116/128 (90.62%), Query Frame = 0
BLAST of Clc08G07700 vs. ExPASy TrEMBL
Match: A0A6J1E540 (cyclin-dependent protein kinase inhibitor SMR1-like OS=Cucurbita moschata OX=3662 GN=LOC111430821 PE=4 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 1.6e-51 Identity = 108/128 (84.38%), Postives = 116/128 (90.62%), Query Frame = 0
BLAST of Clc08G07700 vs. TAIR 10
Match: AT3G10525.1 (LOSS OF GIANT CELLS FROM ORGANS ) HSP 1 Score: 62.8 bits (151), Expect = 2.3e-10 Identity = 51/135 (37.78%), Postives = 68/135 (50.37%), Query Frame = 0
BLAST of Clc08G07700 vs. TAIR 10
Match: AT5G04470.1 (cyclin-dependent protein kinase inhibitors ) HSP 1 Score: 54.3 bits (129), Expect = 8.3e-08 Identity = 39/98 (39.80%), Postives = 54/98 (55.10%), Query Frame = 0
BLAST of Clc08G07700 vs. TAIR 10
Match: AT1G08180.1 (unknown protein; Has 53 Blast hits to 53 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 52; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 44.3 bits (103), Expect = 8.6e-05 Identity = 23/55 (41.82%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of Clc08G07700 vs. TAIR 10
Match: AT5G02420.1 (unknown protein; Has 90 Blast hits to 90 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 90; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 40.8 bits (94), Expect = 9.5e-04 Identity = 34/89 (38.20%), Postives = 47/89 (52.81%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|