Clc06G11960 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATTTCTTAGGGCTTTCGGGTATGCCACGTCGCATTCCTGATTATCCAGATGCTTACGCTGGATGGAATGCCCTTAGCAGTTTTGGCTCTTATATATCCGTAGTTGGGATTCGTCGTTTCTTCGTGGTCGTAACAATCACTTCAAGCAGTGGAAATAACAAAAGATGTGCTCCAAGTCCTTGGGCTGTTGAACAGAATTCAACCACACTGGAATGGATGGTACAAAGTCCTCCAGCTTTTCATACTTTTGGAGAACTTCCTGCTATCAAAGAGACGAAAAGCTATGTGCGCCCCTTTCTCTAA ATGCATTTCTTAGGGCTTTCGGGTATGCCACGTCGCATTCCTGATTATCCAGATGCTTACGCTGGATGGAATGCCCTTAGCAGTTTTGGCTCTTATATATCCGTAGTTGGGATTCGTCGTTTCTTCGTGGTCGTAACAATCACTTCAAGCAGTGGAAATAACAAAAGATGTGCTCCAAGTCCTTGGGCTGTTGAACAGAATTCAACCACACTGGAATGGATGGTACAAAGTCCTCCAGCTTTTCATACTTTTGGAGAACTTCCTGCTATCAAAGAGACGAAAAGCTATGTGCGCCCCTTTCTCTAA ATGCATTTCTTAGGGCTTTCGGGTATGCCACGTCGCATTCCTGATTATCCAGATGCTTACGCTGGATGGAATGCCCTTAGCAGTTTTGGCTCTTATATATCCGTAGTTGGGATTCGTCGTTTCTTCGTGGTCGTAACAATCACTTCAAGCAGTGGAAATAACAAAAGATGTGCTCCAAGTCCTTGGGCTGTTGAACAGAATTCAACCACACTGGAATGGATGGTACAAAGTCCTCCAGCTTTTCATACTTTTGGAGAACTTCCTGCTATCAAAGAGACGAAAAGCTATGTGCGCCCCTTTCTCTAA MHFLGLSGMPRRIPDYPDAYAGWNALSSFGSYISVVGIRRFFVVVTITSSSGNNKRCAPSPWAVEQNSTTLEWMVQSPPAFHTFGELPAIKETKSYVRPFL Homology
BLAST of Clc06G11960 vs. NCBI nr
Match: AMC32792.1 (cytochrome c oxidase subunit 1 [Croton texensis]) HSP 1 Score: 207.2 bits (526), Expect = 6.5e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. NCBI nr
Match: YP_009913642.1 (cytochrome c oxidase subunit 1 [Luffa acutangula] >QLM02677.1 cytochrome c oxidase subunit 1 [Luffa acutangula]) HSP 1 Score: 207.2 bits (526), Expect = 6.5e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. NCBI nr
Match: KAF3973005.1 (hypothetical protein CMV_003549 [Castanea mollissima]) HSP 1 Score: 207.2 bits (526), Expect = 6.5e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. NCBI nr
Match: AKE34087.1 (cytochrome c oxidase subunit 1, partial [Fragaria vesca subsp. bracteata]) HSP 1 Score: 207.2 bits (526), Expect = 6.5e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. NCBI nr
Match: QIS40616.1 (cytochrome c oxidase subunit 1 [Quercus variabilis]) HSP 1 Score: 207.2 bits (526), Expect = 6.5e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy Swiss-Prot
Match: P08743 (Cytochrome c oxidase subunit 1 OS=Oenothera berteroana OX=3950 GN=COX1 PE=3 SV=2) HSP 1 Score: 195.3 bits (495), Expect = 3.4e-49 Identity = 91/98 (92.86%), Postives = 95/98 (96.94%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy Swiss-Prot
Match: P60620 (Cytochrome c oxidase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=COX1 PE=3 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 4.4e-49 Identity = 92/98 (93.88%), Postives = 94/98 (95.92%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy Swiss-Prot
Match: P60621 (Cytochrome c oxidase subunit 1 OS=Raphanus sativus OX=3726 GN=COX1 PE=3 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 4.4e-49 Identity = 92/98 (93.88%), Postives = 94/98 (95.92%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy Swiss-Prot
Match: P14578 (Cytochrome c oxidase subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=COX1 PE=3 SV=2) HSP 1 Score: 191.4 bits (485), Expect = 4.9e-48 Identity = 90/95 (94.74%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy Swiss-Prot
Match: P12786 (Cytochrome c oxidase subunit 1 OS=Pisum sativum OX=3888 GN=COX1 PE=3 SV=2) HSP 1 Score: 190.3 bits (482), Expect = 1.1e-47 Identity = 91/98 (92.86%), Postives = 93/98 (94.90%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy TrEMBL
Match: A0A0B4L2F9 (Cytochrome c oxidase subunit 1 (Fragment) OS=Fragaria iinumae OX=64939 GN=cox1 PE=3 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.2e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy TrEMBL
Match: A0A0B4L0K8 (Cytochrome c oxidase subunit 1 (Fragment) OS=Fragaria mandshurica OX=538574 GN=cox1 PE=3 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.2e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy TrEMBL
Match: A0A0B4L0L2 (Cytochrome c oxidase subunit 1 (Fragment) OS=Fragaria vesca subsp. bracteata OX=157670 GN=cox1 PE=3 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.2e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy TrEMBL
Match: A0A0B4L0I8 (Cytochrome c oxidase subunit 1 (Fragment) OS=Fragaria virginiana OX=101015 GN=cox1 PE=3 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.2e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. ExPASy TrEMBL
Match: F8T949 (Cytochrome c oxidase subunit 1 OS=Rubus coreanus OX=321593 GN=COI PE=3 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.2e-50 Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of Clc06G11960 vs. TAIR 10
Match: ATMG01360.1 (cytochrome oxidase ) HSP 1 Score: 194.9 bits (494), Expect = 3.1e-50 Identity = 92/98 (93.88%), Postives = 94/98 (95.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|