![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Clc03G07720 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.atggagaaactcaccgattacacatgcaaccctgaatatggttccgagtggaaaaagttgatttcgcagcaagaatcgttcataaaaagagtggttgaaattcagctccgaaaatcacggtcgaagggtttggggatgtggaggtgggagagcttcggcagtacgagcatcttcttccacaagcgttcgatctgagagtgaggatgacagcgtactggaagatcgttctgaagagactagtggattgtatggcgcttcatcttgaatacagtatcggtaaattgataaacgaagaacttgaagcggagatcgtgaatgaactgttgggacctagcggcgtcggaatcgagaagatgctggaagaatctcctaaccttgctctgagaagggatagactcaatcggagcattgggcggctccgggagtccaaggaggtggttgccaacattcttgatcggattgcaactttcgacggatga atggagaaactcaccgattacacatgcaaccctgaatatgctccgaaaatcacggtcgaagggtttggggatgtggaggtgggagagcttcggcagtacgagcatcttcttccacaagcgttcgatctgagagtgaggatgacagcgtactggaagatcgttctgaagagactagtggattgtatggcgcttcatcttgaatacagtatcggtaaattgataaacgaagaacttgaagcggagatcgtgaatgaactgttgggacctagcggcgtcggaatcgagaagatgctggaagaatctcctaaccttgctctgagaagggatagactcaatcggagcattgggcggctccgggagtccaaggaggtggttgccaacattcttgatcggattgcaactttcgacggatga atggagaaactcaccgattacacatgcaaccctgaatatgctccgaaaatcacggtcgaagggtttggggatgtggaggtgggagagcttcggcagtacgagcatcttcttccacaagcgttcgatctgagagtgaggatgacagcgtactggaagatcgttctgaagagactagtggattgtatggcgcttcatcttgaatacagtatcggtaaattgataaacgaagaacttgaagcggagatcgtgaatgaactgttgggacctagcggcgtcggaatcgagaagatgctggaagaatctcctaaccttgctctgagaagggatagactcaatcggagcattgggcggctccgggagtccaaggaggtggttgccaacattcttgatcggattgcaactttcgacggatga MEKLTDYTCNPEYAPKITVEGFGDVEVGELRQYEHLLPQAFDLRVRMTAYWKIVLKRLVDCMALHLEYSIGKLINEELEAEIVNELLGPSGVGIEKMLEESPNLALRRDRLNRSIGRLRESKEVVANILDRIATFDG Homology
BLAST of Clc03G07720 vs. NCBI nr
Match: XP_008443645.1 (PREDICTED: dynamin-related protein 4C-like [Cucumis melo] >KAA0057070.1 dynamin-related protein 4C-like [Cucumis melo var. makuwa]) HSP 1 Score: 229.2 bits (583), Expect = 2.2e-56 Identity = 117/159 (73.58%), Postives = 131/159 (82.39%), Query Frame = 0
BLAST of Clc03G07720 vs. NCBI nr
Match: XP_004147422.2 (dynamin-related protein 4C [Cucumis sativus] >KGN65594.1 hypothetical protein Csa_020097 [Cucumis sativus]) HSP 1 Score: 227.3 bits (578), Expect = 8.3e-56 Identity = 116/159 (72.96%), Postives = 128/159 (80.50%), Query Frame = 0
BLAST of Clc03G07720 vs. NCBI nr
Match: XP_022139859.1 (LOW QUALITY PROTEIN: dynamin-related protein 4C-like [Momordica charantia]) HSP 1 Score: 210.3 bits (534), Expect = 1.0e-50 Identity = 108/161 (67.08%), Postives = 124/161 (77.02%), Query Frame = 0
BLAST of Clc03G07720 vs. NCBI nr
Match: XP_024189069.2 (dynamin-related protein 4C [Rosa chinensis]) HSP 1 Score: 183.0 bits (463), Expect = 1.8e-42 Identity = 95/157 (60.51%), Postives = 117/157 (74.52%), Query Frame = 0
BLAST of Clc03G07720 vs. NCBI nr
Match: XP_024189060.1 (dynamin-related protein 4C [Rosa chinensis] >PRQ55667.1 putative dynamin central domain, dynamin, GTPase domain, GTPase effector domain, Dynamin superfamily [Rosa chinensis]) HSP 1 Score: 181.8 bits (460), Expect = 4.0e-42 Identity = 94/157 (59.87%), Postives = 117/157 (74.52%), Query Frame = 0
BLAST of Clc03G07720 vs. ExPASy Swiss-Prot
Match: Q9ZP55 (Dynamin-related protein 4C OS=Arabidopsis thaliana OX=3702 GN=DRP4C PE=2 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 3.6e-30 Identity = 73/157 (46.50%), Postives = 101/157 (64.33%), Query Frame = 0
BLAST of Clc03G07720 vs. ExPASy TrEMBL
Match: A0A5A7UPN5 (Dynamin-related protein 4C-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold96G002610 PE=4 SV=1) HSP 1 Score: 229.2 bits (583), Expect = 1.1e-56 Identity = 117/159 (73.58%), Postives = 131/159 (82.39%), Query Frame = 0
BLAST of Clc03G07720 vs. ExPASy TrEMBL
Match: A0A1S3B818 (dynamin-related protein 4C-like OS=Cucumis melo OX=3656 GN=LOC103487189 PE=4 SV=1) HSP 1 Score: 229.2 bits (583), Expect = 1.1e-56 Identity = 117/159 (73.58%), Postives = 131/159 (82.39%), Query Frame = 0
BLAST of Clc03G07720 vs. ExPASy TrEMBL
Match: A0A0A0LX52 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G467140 PE=4 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 4.0e-56 Identity = 116/159 (72.96%), Postives = 128/159 (80.50%), Query Frame = 0
BLAST of Clc03G07720 vs. ExPASy TrEMBL
Match: A0A6J1CE52 (LOW QUALITY PROTEIN: dynamin-related protein 4C-like OS=Momordica charantia OX=3673 GN=LOC111010670 PE=4 SV=1) HSP 1 Score: 210.3 bits (534), Expect = 5.1e-51 Identity = 108/161 (67.08%), Postives = 124/161 (77.02%), Query Frame = 0
BLAST of Clc03G07720 vs. ExPASy TrEMBL
Match: A0A2P6SAG1 (Putative dynamin central domain, dynamin, GTPase domain, GTPase effector domain, Dynamin superfamily OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0327111 PE=4 SV=1) HSP 1 Score: 181.8 bits (460), Expect = 1.9e-42 Identity = 94/157 (59.87%), Postives = 117/157 (74.52%), Query Frame = 0
BLAST of Clc03G07720 vs. TAIR 10
Match: AT1G60500.1 (Dynamin related protein 4C ) HSP 1 Score: 132.5 bits (332), Expect = 2.6e-31 Identity = 73/157 (46.50%), Postives = 101/157 (64.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|