Cla97C11G215110 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATAGACATAAGTATGGGTGTTATAACACCTTTATTAGAGAAACTTACAAAGCCCTTACCTAATGCCATGGTTCTGGTCAATCTCAAGGAGTTATCCTCTAGTGCCCACAAACTTTTACCAGACGGTATGTTGAGCATACTTCCAATTCCTGCTCATTCACTCGATTTCAATTTCATTATTTATTTATTATGGTTAAATTCCTTGTCACCTCCCATATCAATGAATTGCCTCAGGCACACTCTTGGTTATATCGGTACGAGGTGATGAATCATACAATGATCTGGATATCTTGAAAGAGATTAATGCAACAATGCTTTTTCATGACTTACCATATTTAGAAGACAAGGTCAGCAGAGTGCATGTTGCAAGGAGGTATAACAAAATTCCTTTACGACTGATTTATTAA ATGATAGACATAAGTATGGGTGTTATAACACCTTTATTAGAGAAACTTACAAAGCCCTTACCTAATGCCATGGTTCTGGTCAATCTCAAGGAGTTATCCTCTAGTGCCCACAAACTTTTACCAGACGGCACACTCTTGGTTATATCGGTACGAGGTGATGAATCATACAATGATCTGGATATCTTGAAAGAGATTAATGCAACAATGCTTTTTCATGACTTACCATATTTAGAAGACAAGGTCAGCAGAGTGCATGTTGCAAGGAGGTATAACAAAATTCCTTTACGACTGATTTATTAA ATGATAGACATAAGTATGGGTGTTATAACACCTTTATTAGAGAAACTTACAAAGCCCTTACCTAATGCCATGGTTCTGGTCAATCTCAAGGAGTTATCCTCTAGTGCCCACAAACTTTTACCAGACGGCACACTCTTGGTTATATCGGTACGAGGTGATGAATCATACAATGATCTGGATATCTTGAAAGAGATTAATGCAACAATGCTTTTTCATGACTTACCATATTTAGAAGACAAGGTCAGCAGAGTGCATGTTGCAAGGAGGTATAACAAAATTCCTTTACGACTGATTTATTAA MIDISMGVITPLLEKLTKPLPNAMVLVNLKELSSSAHKLLPDGTLLVISVRGDESYNDLDILKEINATMLFHDLPYLEDKVSRVHVARRYNKIPLRLIY Homology
BLAST of Cla97C11G215110 vs. NCBI nr
Match: XP_008463938.1 (PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Cucumis melo] >XP_016903081.1 PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Cucumis melo] >XP_016903086.1 PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Cucumis melo] >KAA0056778.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) [Cucumis melo var. makuwa] >TYJ97601.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) [Cucumis melo var. makuwa]) HSP 1 Score: 155.6 bits (392), Expect = 2.2e-34 Identity = 79/89 (88.76%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. NCBI nr
Match: XP_038895330.1 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Benincasa hispida] >XP_038895331.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Benincasa hispida]) HSP 1 Score: 154.5 bits (389), Expect = 4.9e-34 Identity = 78/89 (87.64%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Cla97C11G215110 vs. NCBI nr
Match: XP_004148774.1 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Cucumis sativus] >XP_011653452.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Cucumis sativus] >KGN64731.1 hypothetical protein Csa_014075 [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-33 Identity = 78/89 (87.64%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. NCBI nr
Match: AEM42998.1 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Siraitia grosvenorii]) HSP 1 Score: 152.5 bits (384), Expect = 1.9e-33 Identity = 77/89 (86.52%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. NCBI nr
Match: KAG7036879.1 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151.0 bits (380), Expect = 5.5e-33 Identity = 76/89 (85.39%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy Swiss-Prot
Match: F4K0E8 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISPG PE=1 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 9.0e-31 Identity = 65/89 (73.03%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy Swiss-Prot
Match: Q6K8J4 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISPG PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-25 Identity = 57/90 (63.33%), Postives = 73/90 (81.11%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy TrEMBL
Match: A0A1S4E4C1 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (Ferredoxin), chloroplastic OS=Cucumis melo OX=3656 GN=LOC103501942 PE=3 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 1.1e-34 Identity = 79/89 (88.76%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy TrEMBL
Match: A0A5D3BG37 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (Ferredoxin) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold690G00320 PE=3 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 1.1e-34 Identity = 79/89 (88.76%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy TrEMBL
Match: A0A0A0LXJ8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G084300 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 5.3e-34 Identity = 78/89 (87.64%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy TrEMBL
Match: K7NBL1 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase OS=Siraitia grosvenorii OX=190515 GN=HDS PE=2 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 9.1e-34 Identity = 77/89 (86.52%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of Cla97C11G215110 vs. ExPASy TrEMBL
Match: A0A6J1KDW7 (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (Ferredoxin), chloroplastic-like OS=Cucurbita maxima OX=3661 GN=LOC111493449 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 2.6e-33 Identity = 76/89 (85.39%), Postives = 84/89 (94.38%), Query Frame = 0
BLAST of Cla97C11G215110 vs. TAIR 10
Match: AT5G60600.1 (4-hydroxy-3-methylbut-2-enyl diphosphate synthase ) HSP 1 Score: 134.0 bits (336), Expect = 6.4e-32 Identity = 65/89 (73.03%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of Cla97C11G215110 vs. TAIR 10
Match: AT5G60600.2 (4-hydroxy-3-methylbut-2-enyl diphosphate synthase ) HSP 1 Score: 134.0 bits (336), Expect = 6.4e-32 Identity = 65/89 (73.03%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of Cla97C11G215110 vs. TAIR 10
Match: AT5G60600.3 (4-hydroxy-3-methylbut-2-enyl diphosphate synthase ) HSP 1 Score: 134.0 bits (336), Expect = 6.4e-32 Identity = 65/89 (73.03%), Postives = 78/89 (87.64%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|