Cla97C07G135730 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACATATAATTGTGATTGTTACAAACGTACGGGGTCGGTTAATTTTCTAGTCCTCTACGGATACGTGTGGATTCAAAGGTACAAGAAGAGGGACACTATTTGCCACTCAAACCACAGCAGAAAATGCTATTCGGGCAGTAGTTGATCAAGGTATGCAACGAGCCGAAGTTATGATAAAGGGCCCTGGTCTAGAGTTCTATCATTAA ATGACATATAATTGTGATTGTTACAAACGTACGGGGTCGTCCTCTACGGATACGTGTGGATTCAAAGGTACAAGAAGAGGGACACTATTTGCCACTCAAACCACAGCAGAAAATGCTATTCGGGCAGTAGTTGATCAAGGTATGCAACGAGCCGAAGTTATGATAAAGGGCCCTGGTCTAGAGTTCTATCATTAA ATGACATATAATTGTGATTGTTACAAACGTACGGGGTCGTCCTCTACGGATACGTGTGGATTCAAAGGTACAAGAAGAGGGACACTATTTGCCACTCAAACCACAGCAGAAAATGCTATTCGGGCAGTAGTTGATCAAGGTATGCAACGAGCCGAAGTTATGATAAAGGGCCCTGGTCTAGAGTTCTATCATTAA MTYNCDCYKRTGSSSTDTCGFKGTRRGTLFATQTTAENAIRAVVDQGMQRAEVMIKGPGLEFYH Homology
BLAST of Cla97C07G135730 vs. NCBI nr
Match: QYH50881.1 (ribosomal protein S11 [Saussurea tanguensis]) HSP 1 Score: 82.4 bits (202), Expect = 1.5e-12 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Cla97C07G135730 vs. NCBI nr
Match: YP_009634717.1 (ribosomal protein S11 [Nyctanthes arbor-tristis] >QBS49769.1 ribosomal protein S11 [Nyctanthes arbor-tristis]) HSP 1 Score: 82.0 bits (201), Expect = 2.0e-12 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. NCBI nr
Match: KAD4981935.1 (hypothetical protein E3N88_18606 [Mikania micrantha]) HSP 1 Score: 82.0 bits (201), Expect = 2.0e-12 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Cla97C07G135730 vs. NCBI nr
Match: YP_009905930.1 (ribosomal protein S11 [Vasconcellea cundinamarcensis] >QLG90337.1 ribosomal protein S11 [Vasconcellea cundinamarcensis]) HSP 1 Score: 81.6 bits (200), Expect = 2.6e-12 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Cla97C07G135730 vs. NCBI nr
Match: YP_009752191.1 (ribosomal protein S11 [Linnaeosicyos amara] >QIT05601.1 ribosomal protein S11 [Linnaeosicyos amara]) HSP 1 Score: 81.6 bits (200), Expect = 2.6e-12 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy Swiss-Prot
Match: A0ZZ68 (30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.9e-15 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy Swiss-Prot
Match: Q2L937 (30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.9e-15 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy Swiss-Prot
Match: Q6EW19 (30S ribosomal protein S11, chloroplastic OS=Nymphaea alba OX=34301 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.9e-15 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy Swiss-Prot
Match: B2LMM6 (30S ribosomal protein S11, chloroplastic OS=Guizotia abyssinica OX=4230 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.0e-14 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy Swiss-Prot
Match: B1A968 (30S ribosomal protein S11, chloroplastic OS=Carica papaya OX=3649 GN=rps11 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-14 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy TrEMBL
Match: A0A5N6NML1 (S1-like domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_18606 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 9.7e-13 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy TrEMBL
Match: A0A4D5Y202 (30S ribosomal protein S11, chloroplastic OS=Nyctanthes arbor-tristis OX=41398 GN=rps11 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 9.7e-13 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy TrEMBL
Match: A0A7D5QJ83 (30S ribosomal protein S11, chloroplastic OS=Vasconcellea cundinamarcensis OX=35926 GN=rps11 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy TrEMBL
Match: A0A6H0ETH3 (30S ribosomal protein S11, chloroplastic OS=Linnaeosicyos amara OX=386243 GN=rps11 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. ExPASy TrEMBL
Match: A0A6M3RIU1 (30S ribosomal protein S11, chloroplastic OS=Euphorbia larica OX=1031526 GN=rps11 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C07G135730 vs. TAIR 10
Match: ATCG00750.1 (ribosomal protein S11 ) HSP 1 Score: 77.4 bits (189), Expect = 4.6e-15 Identity = 39/47 (82.98%), Postives = 40/47 (85.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|