Cla97C07G135640 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCTTTATCTCCCAGTTAGCCATCAATTATTCCAACTTATCACAGGTTCATGCAGCAGAAAACGTGAAGAGCTTTGATGAAATTGAATTTGAAAAGGTTCTTGGCAGAAAGTTTGCTCATCGTGATGAAGATTATGATTTAATGCTGGGCGTTGTTCGTGAAACCCCCCCAGAGCTTGTCCTTCCAGATAACATACTGGCTGACAAAGTACCAAGATCCTGTTGA ATGGCCTTTATCTCCCAGTTAGCCATCAATTATTCCAACTTATCACAGGTTCATGCAGCAGAAAACGTGAAGAGCTTTGATGAAATTGAATTTGAAAAGGTTCTTGGCAGAAAGTTTGCTCATCGTGATGAAGATTATGATTTAATGCTGGGCGTTGTTCGTGAAACCCCCCCAGAGCTTGTCCTTCCAGATAACATACTGGCTGACAAAGTACCAAGATCCTGTTGA ATGGCCTTTATCTCCCAGTTAGCCATCAATTATTCCAACTTATCACAGGTTCATGCAGCAGAAAACGTGAAGAGCTTTGATGAAATTGAATTTGAAAAGGTTCTTGGCAGAAAGTTTGCTCATCGTGATGAAGATTATGATTTAATGCTGGGCGTTGTTCGTGAAACCCCCCCAGAGCTTGTCCTTCCAGATAACATACTGGCTGACAAAGTACCAAGATCCTGTTGA MAFISQLAINYSNLSQVHAAENVKSFDEIEFEKVLGRKFAHRDEDYDLMLGVVRETPPELVLPDNILADKVPRSC Homology
BLAST of Cla97C07G135640 vs. NCBI nr
Match: XP_038890583.1 (gamma carbonic anhydrase 1, mitochondrial-like [Benincasa hispida]) HSP 1 Score: 134.8 bits (338), Expect = 3.1e-28 Identity = 67/74 (90.54%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Cla97C07G135640 vs. NCBI nr
Match: XP_022942844.1 (gamma carbonic anhydrase 1, mitochondrial-like [Cucurbita moschata]) HSP 1 Score: 132.1 bits (331), Expect = 2.0e-27 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of Cla97C07G135640 vs. NCBI nr
Match: XP_022982276.1 (gamma carbonic anhydrase 1, mitochondrial-like [Cucurbita maxima]) HSP 1 Score: 132.1 bits (331), Expect = 2.0e-27 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of Cla97C07G135640 vs. NCBI nr
Match: XP_023533941.1 (gamma carbonic anhydrase 1, mitochondrial-like [Cucurbita pepo subsp. pepo] >KAG7031225.1 Gamma carbonic anhydrase 1, mitochondrial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 132.1 bits (331), Expect = 2.0e-27 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of Cla97C07G135640 vs. NCBI nr
Match: KAG7015315.1 (Gamma carbonic anhydrase 1, mitochondrial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 131.3 bits (329), Expect = 3.4e-27 Identity = 65/74 (87.84%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy Swiss-Prot
Match: Q9FWR5 (Gamma carbonic anhydrase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA1 PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.2e-20 Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy Swiss-Prot
Match: Q9C6B3 (Gamma carbonic anhydrase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA2 PE=1 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.7e-19 Identity = 43/72 (59.72%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy Swiss-Prot
Match: Q94AU7 (Gamma carbonic anhydrase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA3 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.4e-07 Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy TrEMBL
Match: A0A6J1IYW2 (gamma carbonic anhydrase 1, mitochondrial-like OS=Cucurbita maxima OX=3661 GN=LOC111481151 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 9.6e-28 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy TrEMBL
Match: A0A6J1FSI1 (gamma carbonic anhydrase 1, mitochondrial-like OS=Cucurbita moschata OX=3662 GN=LOC111447752 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 9.6e-28 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy TrEMBL
Match: A0A6J1C4F3 (gamma carbonic anhydrase 1, mitochondrial-like OS=Momordica charantia OX=3673 GN=LOC111008390 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.6e-27 Identity = 65/74 (87.84%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy TrEMBL
Match: A0A6J1ERC7 (gamma carbonic anhydrase 1, mitochondrial-like OS=Cucurbita moschata OX=3662 GN=LOC111435854 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.6e-27 Identity = 65/74 (87.84%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of Cla97C07G135640 vs. ExPASy TrEMBL
Match: A0A5D3CXP6 (Gamma carbonic anhydrase 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G005040 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 1.1e-26 Identity = 65/74 (87.84%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of Cla97C07G135640 vs. TAIR 10
Match: AT1G19580.1 (gamma carbonic anhydrase 1 ) HSP 1 Score: 98.6 bits (244), Expect = 2.3e-21 Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = 0
BLAST of Cla97C07G135640 vs. TAIR 10
Match: AT1G47260.1 (gamma carbonic anhydrase 2 ) HSP 1 Score: 95.5 bits (236), Expect = 1.9e-20 Identity = 43/72 (59.72%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of Cla97C07G135640 vs. TAIR 10
Match: AT5G66510.1 (gamma carbonic anhydrase 3 ) HSP 1 Score: 55.8 bits (133), Expect = 1.7e-08 Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Cla97C07G135640 vs. TAIR 10
Match: AT5G66510.2 (gamma carbonic anhydrase 3 ) HSP 1 Score: 55.8 bits (133), Expect = 1.7e-08 Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|