![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
ClCG03G005420 (gene) Watermelon (Charleston Gray) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCTCATCACAAGAATCCGAATCCAATCCACGAGACTTGGAGTTGAAAATTATGAAGAAGATCAAGTGCGAGCTTTGCAATTGTAGAGCCAATGCGTATTGTGAATCGGACGAAGCCAGTTTGTGTTGGAGGTGCGACGCCAATGTTCATTCAGCCAATTTCATTGTGGAAAAGCATTCAAGGATTTTGCTATGCCAAATTTGCCAATCTCCCACTCCTTGGACTGCCACTGGCCCCAAGCTTGGCCCTACCCTTTCCCTTTGTCAGTTTTGTGTTATTCCCCAAAATGTTGCCTCTCTACAAATTCATCATCATCAGGACAATCGCCATTCTGCTTCCCCCACCAGCAGAGACCTTGCTGACGATGATGAAGACAATCAAGTGGTTCCGTTGTCGCCGCCGCCAATTTCCAGCTAG ATGCCCTCATCACAAGAATCCGAATCCAATCCACGAGACTTGGAGTTGAAAATTATGAAGAAGATCAAGTGCGAGCTTTGCAATTGTAGAGCCAATGCGTATTGTGAATCGGACGAAGCCAGTTTGTGTTGGAGGTGCGACGCCAATGTTCATTCAGCCAATTTCATTGTGGAAAAGCATTCAAGGATTTTGCTATGCCAAATTTGCCAATCTCCCACTCCTTGGACTGCCACTGGCCCCAAGCTTGGCCCTACCCTTTCCCTTTGTCAGTTTTGTGTTATTCCCCAAAATGTTGCCTCTCTACAAATTCATCATCATCAGGACAATCGCCATTCTGCTTCCCCCACCAGCAGAGACCTTGCTGACGATGATGAAGACAATCAAGTGGTTCCGTTGTCGCCGCCGCCAATTTCCAGCTAG ATGCCCTCATCACAAGAATCCGAATCCAATCCACGAGACTTGGAGTTGAAAATTATGAAGAAGATCAAGTGCGAGCTTTGCAATTGTAGAGCCAATGCGTATTGTGAATCGGACGAAGCCAGTTTGTGTTGGAGGTGCGACGCCAATGTTCATTCAGCCAATTTCATTGTGGAAAAGCATTCAAGGATTTTGCTATGCCAAATTTGCCAATCTCCCACTCCTTGGACTGCCACTGGCCCCAAGCTTGGCCCTACCCTTTCCCTTTGTCAGTTTTGTGTTATTCCCCAAAATGTTGCCTCTCTACAAATTCATCATCATCAGGACAATCGCCATTCTGCTTCCCCCACCAGCAGAGACCTTGCTGACGATGATGAAGACAATCAAGTGGTTCCGTTGTCGCCGCCGCCAATTTCCAGCTAG MPSSQESESNPRDLELKIMKKIKCELCNCRANAYCESDEASLCWRCDANVHSANFIVEKHSRILLCQICQSPTPWTATGPKLGPTLSLCQFCVIPQNVASLQIHHHQDNRHSASPTSRDLADDDEDNQVVPLSPPPISS Homology
BLAST of ClCG03G005420 vs. NCBI nr
Match: XP_038895968.1 (zinc finger protein CONSTANS-LIKE 9-like [Benincasa hispida]) HSP 1 Score: 250.4 bits (638), Expect = 9.3e-63 Identity = 122/144 (84.72%), Postives = 130/144 (90.28%), Query Frame = 0
BLAST of ClCG03G005420 vs. NCBI nr
Match: XP_008441923.1 (PREDICTED: B-box zinc finger protein 32-like [Cucumis melo] >KAA0056935.1 B-box zinc finger protein 32-like [Cucumis melo var. makuwa] >TYK26363.1 B-box zinc finger protein 32-like [Cucumis melo var. makuwa]) HSP 1 Score: 246.9 bits (629), Expect = 1.0e-61 Identity = 120/142 (84.51%), Postives = 127/142 (89.44%), Query Frame = 0
BLAST of ClCG03G005420 vs. NCBI nr
Match: KAE8652697.1 (hypothetical protein Csa_014317 [Cucumis sativus]) HSP 1 Score: 230.7 bits (587), Expect = 7.6e-57 Identity = 112/140 (80.00%), Postives = 122/140 (87.14%), Query Frame = 0
BLAST of ClCG03G005420 vs. NCBI nr
Match: XP_023542180.1 (zinc finger protein CONSTANS-LIKE 9-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 163.7 bits (413), Expect = 1.1e-36 Identity = 80/119 (67.23%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of ClCG03G005420 vs. NCBI nr
Match: KAG6573228.1 (putative zinc finger protein CONSTANS-LIKE 11, partial [Cucurbita argyrosperma subsp. sororia] >KAG7012401.1 putative zinc finger protein CONSTANS-LIKE 11, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 162.5 bits (410), Expect = 2.5e-36 Identity = 81/121 (66.94%), Postives = 93/121 (76.86%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy Swiss-Prot
Match: Q1G3I2 (B-box domain protein 30 OS=Arabidopsis thaliana OX=3702 GN=MIP1A PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.0e-08 Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy Swiss-Prot
Match: O23379 (Putative zinc finger protein CONSTANS-LIKE 11 OS=Arabidopsis thaliana OX=3702 GN=COL11 PE=1 SV=2) HSP 1 Score: 60.8 bits (146), Expect = 1.4e-08 Identity = 31/72 (43.06%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy Swiss-Prot
Match: Q9LRM4 (B-box domain protein 31 OS=Arabidopsis thaliana OX=3702 GN=MIP1B PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.8e-08 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy Swiss-Prot
Match: Q9LUA9 (Zinc finger protein CONSTANS-LIKE 10 OS=Arabidopsis thaliana OX=3702 GN=COL10 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 3.0e-08 Identity = 37/104 (35.58%), Postives = 53/104 (50.96%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy Swiss-Prot
Match: Q96502 (Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=COL2 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 3.0e-08 Identity = 40/125 (32.00%), Postives = 59/125 (47.20%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy TrEMBL
Match: A0A5A7UTR2 (B-box zinc finger protein 32-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold861G00230 PE=4 SV=1) HSP 1 Score: 246.9 bits (629), Expect = 5.0e-62 Identity = 120/142 (84.51%), Postives = 127/142 (89.44%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy TrEMBL
Match: A0A1S3B4I3 (B-box zinc finger protein 32-like OS=Cucumis melo OX=3656 GN=LOC103485915 PE=4 SV=1) HSP 1 Score: 246.9 bits (629), Expect = 5.0e-62 Identity = 120/142 (84.51%), Postives = 127/142 (89.44%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy TrEMBL
Match: A0A0A0LS80 (B box-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G071810 PE=4 SV=1) HSP 1 Score: 210.3 bits (534), Expect = 5.1e-51 Identity = 101/125 (80.80%), Postives = 109/125 (87.20%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy TrEMBL
Match: A0A6J1GR34 (zinc finger protein CONSTANS-LIKE 9-like OS=Cucurbita moschata OX=3662 GN=LOC111456702 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 2.6e-34 Identity = 79/121 (65.29%), Postives = 89/121 (73.55%), Query Frame = 0
BLAST of ClCG03G005420 vs. ExPASy TrEMBL
Match: A0A6J1JY69 (zinc finger protein CONSTANS-LIKE 9-like OS=Cucurbita maxima OX=3661 GN=LOC111489941 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 9.8e-34 Identity = 78/121 (64.46%), Postives = 91/121 (75.21%), Query Frame = 0
BLAST of ClCG03G005420 vs. TAIR 10
Match: AT4G27310.1 (B-box type zinc finger family protein ) HSP 1 Score: 112.5 bits (280), Expect = 2.8e-25 Identity = 48/75 (64.00%), Postives = 56/75 (74.67%), Query Frame = 0
BLAST of ClCG03G005420 vs. TAIR 10
Match: AT5G54470.1 (B-box type zinc finger family protein ) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-23 Identity = 59/127 (46.46%), Postives = 75/127 (59.06%), Query Frame = 0
BLAST of ClCG03G005420 vs. TAIR 10
Match: AT4G15248.1 (B-box type zinc finger family protein ) HSP 1 Score: 61.2 bits (147), Expect = 7.4e-10 Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of ClCG03G005420 vs. TAIR 10
Match: AT4G15250.1 (B-box type zinc finger protein with CCT domain ) HSP 1 Score: 60.8 bits (146), Expect = 9.7e-10 Identity = 31/72 (43.06%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of ClCG03G005420 vs. TAIR 10
Match: AT3G21890.1 (B-box type zinc finger family protein ) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-09 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (Charleston Gray) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|