ClCG02G003475 (gene) Watermelon (Charleston Gray) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGGATACATTGAAGAAGAAATCAGAATTAGTAGTTTTCCTAAAGTTCAAGAAACATTTATTCGAATATCTGGTTACGGCGAACAAACTGATATACATTCTCCTCAAATAATTATGGAAGAATCTTTCATATTCTCTGCTTCCTTCCCTTTGGCACCTGATATCAACTGGAAAACGAAAGCAGTAAGATCTTTTCTTTCCCTCCTTAGCTAAAACTAATTTGTCTCTGATGTTGATATTATTTGAATATGTGAATGAAATCCTTGACACTATTGAACTTGATAGCATAAATGGTATGTTGGTTCGCATAGCTGGTATTAGAAAATATGAACCTGACCTGATTAGGTTGAGGGGTGAAGCCAATGACATAATAGGTAAGAGAAGTCCATCTATCTTTAGTTTTCATTTCAGTTGGTTGGTGGTTTATCCGGACTCCAAATGGACTTAAATGACGGTGGATGTCTCATGCAGCATACGGTGTACCCAAAACCAATCTTATCCTCTTTCATTTTGTATATGAGGTAA ATGGGTGGATACATTGAAGAAGAAATCAGAATTAGTAGTTTTCCTAAAGTTCAAGAAACATTTATTCGAATATCTGGTTACGGCGAACAAACTGATATACATTCTCCTCAAATAATTATGGAAGAATCTTTCATATTCTCTGCTTCCTTCCCTTTGGCACCTGATATCAACTGGAAAACGAAAGCATTGGTTGGTGGTTTATCCGGACTCCAAATGGACTTAAATGACGGTGGATGTCTCATGCAGCATACGGTGTACCCAAAACCAATCTTATCCTCTTTCATTTTGTATATGAGGTAA ATGGGTGGATACATTGAAGAAGAAATCAGAATTAGTAGTTTTCCTAAAGTTCAAGAAACATTTATTCGAATATCTGGTTACGGCGAACAAACTGATATACATTCTCCTCAAATAATTATGGAAGAATCTTTCATATTCTCTGCTTCCTTCCCTTTGGCACCTGATATCAACTGGAAAACGAAAGCATTGGTTGGTGGTTTATCCGGACTCCAAATGGACTTAAATGACGGTGGATGTCTCATGCAGCATACGGTGTACCCAAAACCAATCTTATCCTCTTTCATTTTGTATATGAGGTAA MGGYIEEEIRISSFPKVQETFIRISGYGEQTDIHSPQIIMEESFIFSASFPLAPDINWKTKALVGGLSGLQMDLNDGGCLMQHTVYPKPILSSFILYMR Homology
BLAST of ClCG02G003475 vs. NCBI nr
Match: XP_038903616.1 (pleiotropic drug resistance protein 3-like isoform X2 [Benincasa hispida]) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-17 Identity = 50/70 (71.43%), Postives = 55/70 (78.57%), Query Frame = 0
BLAST of ClCG02G003475 vs. NCBI nr
Match: XP_038903615.1 (pleiotropic drug resistance protein 3-like isoform X1 [Benincasa hispida]) HSP 1 Score: 95.9 bits (237), Expect = 2.1e-16 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. NCBI nr
Match: XP_008443151.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Cucumis melo]) HSP 1 Score: 93.2 bits (230), Expect = 1.3e-15 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. NCBI nr
Match: XP_008443150.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 93.2 bits (230), Expect = 1.3e-15 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. NCBI nr
Match: KAA0053948.1 (pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo var. makuwa] >TYK25456.1 pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 93.2 bits (230), Expect = 1.3e-15 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy Swiss-Prot
Match: Q9LFH0 (ABC transporter G family member 37 OS=Arabidopsis thaliana OX=3702 GN=ABCG37 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.3e-16 Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy Swiss-Prot
Match: Q5W274 (Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum OX=4097 GN=PDR3 PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.4e-15 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy Swiss-Prot
Match: Q9ZUT8 (ABC transporter G family member 33 OS=Arabidopsis thaliana OX=3702 GN=ABCG33 PE=2 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.8e-15 Identity = 41/59 (69.49%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy Swiss-Prot
Match: Q7PC86 (ABC transporter G family member 35 OS=Arabidopsis thaliana OX=3702 GN=ABCG35 PE=2 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.3e-15 Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy Swiss-Prot
Match: Q9XIE2 (ABC transporter G family member 36 OS=Arabidopsis thaliana OX=3702 GN=ABCG36 PE=1 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 7.0e-15 Identity = 38/62 (61.29%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy TrEMBL
Match: A0A5A7UFY6 (Pleiotropic drug resistance protein 3-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G006020 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 6.5e-16 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy TrEMBL
Match: A0A1S3B6X0 (pleiotropic drug resistance protein 3-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103486825 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 6.5e-16 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy TrEMBL
Match: A0A1S3B7C4 (pleiotropic drug resistance protein 3-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103486825 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 6.5e-16 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy TrEMBL
Match: V4S2E0 (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10013618mg PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 2.5e-15 Identity = 44/60 (73.33%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. ExPASy TrEMBL
Match: A0A2H5PY05 (ABC transporter domain-containing protein OS=Citrus unshiu OX=55188 GN=CUMW_178040 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 2.5e-15 Identity = 44/60 (73.33%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of ClCG02G003475 vs. TAIR 10
Match: AT3G53480.1 (pleiotropic drug resistance 9 ) HSP 1 Score: 84.7 bits (208), Expect = 4.5e-17 Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 0
BLAST of ClCG02G003475 vs. TAIR 10
Match: AT2G37280.1 (pleiotropic drug resistance 5 ) HSP 1 Score: 83.2 bits (204), Expect = 1.3e-16 Identity = 41/59 (69.49%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of ClCG02G003475 vs. TAIR 10
Match: AT1G15210.1 (pleiotropic drug resistance 7 ) HSP 1 Score: 81.6 bits (200), Expect = 3.8e-16 Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 0
BLAST of ClCG02G003475 vs. TAIR 10
Match: AT1G59870.1 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 81.3 bits (199), Expect = 4.9e-16 Identity = 38/62 (61.29%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of ClCG02G003475 vs. TAIR 10
Match: AT3G16340.1 (pleiotropic drug resistance 1 ) HSP 1 Score: 75.1 bits (183), Expect = 3.5e-14 Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (Charleston Gray) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|