Chy8G148350 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAACTGAATCACATAGCTGTGCCATTGCTATTTCTTCTTCTTGCTGCCTTCGATTTGGGGTTTTCCGTCGAAGACCCATTTATCAGGATGAAACTGGGAGGCGTTCGCGATTACATCGGCGCCCAGAACAGCGTTGAAATCGACTCTCTCGCTCGTTTTGCAGTTCAAGAACACAACAACAAAGAGGTATTTTCCTTTGTTATCTTAAGTTTTACTTCTCCTCACTCCCCTTTTCCTTATATTGGTATTGTTTAATTTCTGGGTACGTCTCAATCTCTCCTTTTCTTTATTGTTCCGCTTAGAATCGAGTTAATTTCTCACTTAATTCGTTACCCATGTTTCCGATTTCTCATGGGTGCTTTCGATTTGTTTTAATCACCAATTCTGAGTTCTTGTTTCTTTGGTACAGAACGGTCTTTTGGAATTTGAGCGAGTGTTGAAAGCTAAAGAACAGATAGTTGCTGGTAAATTGTATCATCTTACATTGGAAGCCATTGATGGTGGCAAGAAGAAGGTTTATGAAGCCAAAGTGTGGGTGAAGCCTTGGATGAACTTCCAACAGTTGCAGGAATTCAAGCTATGCACATGA ATGAAACTGAATCACATAGCTGTGCCATTGCTATTTCTTCTTCTTGCTGCCTTCGATTTGGGGTTTTCCGTCGAAGACCCATTTATCAGGATGAAACTGGGAGGCGTTCGCGATTACATCGGCGCCCAGAACAGCGTTGAAATCGACTCTCTCGCTCGTTTTGCAGTTCAAGAACACAACAACAAAGAGAACGGTCTTTTGGAATTTGAGCGAGTGTTGAAAGCTAAAGAACAGATAGTTGCTGGTAAATTGTATCATCTTACATTGGAAGCCATTGATGGTGGCAAGAAGAAGGTTTATGAAGCCAAAGTGTGGGTGAAGCCTTGGATGAACTTCCAACAGTTGCAGGAATTCAAGCTATGCACATGA ATGAAACTGAATCACATAGCTGTGCCATTGCTATTTCTTCTTCTTGCTGCCTTCGATTTGGGGTTTTCCGTCGAAGACCCATTTATCAGGATGAAACTGGGAGGCGTTCGCGATTACATCGGCGCCCAGAACAGCGTTGAAATCGACTCTCTCGCTCGTTTTGCAGTTCAAGAACACAACAACAAAGAGAACGGTCTTTTGGAATTTGAGCGAGTGTTGAAAGCTAAAGAACAGATAGTTGCTGGTAAATTGTATCATCTTACATTGGAAGCCATTGATGGTGGCAAGAAGAAGGTTTATGAAGCCAAAGTGTGGGTGAAGCCTTGGATGAACTTCCAACAGTTGCAGGAATTCAAGCTATGCACATGA MKLNHIAVPLLFLLLAAFDLGFSVEDPFIRMKLGGVRDYIGAQNSVEIDSLARFAVQEHNNKENGLLEFERVLKAKEQIVAGKLYHLTLEAIDGGKKKVYEAKVWVKPWMNFQQLQEFKLCT* Homology
BLAST of Chy8G148350 vs. ExPASy Swiss-Prot
Match: Q8H0X6 (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=CYS6 PE=1 SV=2) HSP 1 Score: 136.0 bits (341), Expect = 3.0e-31 Identity = 69/113 (61.06%), Postives = 86/113 (76.11%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy Swiss-Prot
Match: Q06445 (Cysteine proteinase inhibitor OS=Vigna unguiculata OX=3917 PE=1 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 3.3e-30 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy Swiss-Prot
Match: Q0JNR2 (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0270100 PE=2 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 9.5e-30 Identity = 73/120 (60.83%), Postives = 88/120 (73.33%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy Swiss-Prot
Match: Q41906 (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=CYS3 PE=2 SV=2) HSP 1 Score: 130.6 bits (327), Expect = 1.2e-29 Identity = 60/89 (67.42%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy Swiss-Prot
Match: Q8LC76 (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=CYS7 PE=2 SV=2) HSP 1 Score: 127.9 bits (320), Expect = 8.1e-29 Identity = 63/95 (66.32%), Postives = 73/95 (76.84%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy TrEMBL
Match: A0A1S4E0R5 (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103495847 PE=3 SV=1) HSP 1 Score: 238.0 bits (606), Expect = 2.0e-59 Identity = 115/122 (94.26%), Postives = 121/122 (99.18%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy TrEMBL
Match: A0A5D3CEB5 (Cysteine proteinase inhibitor OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold447G00160 PE=3 SV=1) HSP 1 Score: 238.0 bits (606), Expect = 2.0e-59 Identity = 115/122 (94.26%), Postives = 121/122 (99.18%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy TrEMBL
Match: A0A6J1HVR4 (Cysteine proteinase inhibitor OS=Cucurbita maxima OX=3661 GN=LOC111467290 PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 7.0e-52 Identity = 103/122 (84.43%), Postives = 112/122 (91.80%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy TrEMBL
Match: A0A6J1F2Q3 (Cysteine proteinase inhibitor OS=Cucurbita moschata OX=3662 GN=LOC111439234 PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 7.0e-52 Identity = 104/121 (85.95%), Postives = 111/121 (91.74%), Query Frame = 0
BLAST of Chy8G148350 vs. ExPASy TrEMBL
Match: A0A5N6RV79 (Cysteine proteinase inhibitor OS=Carpinus fangiana OX=176857 GN=FH972_019958 PE=3 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 2.9e-37 Identity = 82/111 (73.87%), Postives = 94/111 (84.68%), Query Frame = 0
BLAST of Chy8G148350 vs. NCBI nr
Match: XP_008455746.1 (PREDICTED: cysteine proteinase inhibitor A [Cucumis melo] >XP_016901818.1 PREDICTED: cysteine proteinase inhibitor A [Cucumis melo] >XP_016901819.1 PREDICTED: cysteine proteinase inhibitor A [Cucumis melo] >KAA0025834.1 cysteine proteinase inhibitor A [Cucumis melo var. makuwa] >TYK09622.1 cysteine proteinase inhibitor A [Cucumis melo var. makuwa]) HSP 1 Score: 238 bits (606), Expect = 8.48e-79 Identity = 115/122 (94.26%), Postives = 121/122 (99.18%), Query Frame = 0
BLAST of Chy8G148350 vs. NCBI nr
Match: XP_038880981.1 (cysteine proteinase inhibitor A-like [Benincasa hispida]) HSP 1 Score: 225 bits (574), Expect = 1.43e-73 Identity = 111/121 (91.74%), Postives = 115/121 (95.04%), Query Frame = 0
BLAST of Chy8G148350 vs. NCBI nr
Match: XP_022967919.1 (cysteine proteinase inhibitor A-like [Cucurbita maxima] >XP_022967920.1 cysteine proteinase inhibitor A-like [Cucurbita maxima] >XP_022967921.1 cysteine proteinase inhibitor A-like [Cucurbita maxima]) HSP 1 Score: 213 bits (541), Expect = 6.95e-69 Identity = 103/122 (84.43%), Postives = 112/122 (91.80%), Query Frame = 0
BLAST of Chy8G148350 vs. NCBI nr
Match: XP_022932782.1 (cysteine proteinase inhibitor A-like [Cucurbita moschata] >XP_022932783.1 cysteine proteinase inhibitor A-like [Cucurbita moschata] >XP_022932784.1 cysteine proteinase inhibitor A-like [Cucurbita moschata] >KAG7034455.1 hypothetical protein SDJN02_04184 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 212 bits (540), Expect = 9.88e-69 Identity = 104/121 (85.95%), Postives = 111/121 (91.74%), Query Frame = 0
BLAST of Chy8G148350 vs. NCBI nr
Match: XP_023543498.1 (cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo] >XP_023543500.1 cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo] >XP_023543501.1 cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 206 bits (525), Expect = 1.91e-66 Identity = 100/121 (82.64%), Postives = 109/121 (90.08%), Query Frame = 0
BLAST of Chy8G148350 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 136.0 bits (341), Expect = 2.1e-32 Identity = 69/113 (61.06%), Postives = 86/113 (76.11%), Query Frame = 0
BLAST of Chy8G148350 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 131.3 bits (329), Expect = 5.2e-31 Identity = 61/87 (70.11%), Postives = 74/87 (85.06%), Query Frame = 0
BLAST of Chy8G148350 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 130.6 bits (327), Expect = 8.8e-31 Identity = 60/89 (67.42%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of Chy8G148350 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 127.9 bits (320), Expect = 5.7e-30 Identity = 63/95 (66.32%), Postives = 73/95 (76.84%), Query Frame = 0
BLAST of Chy8G148350 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 98.2 bits (243), Expect = 4.9e-21 Identity = 47/86 (54.65%), Postives = 61/86 (70.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|