Chy6G124760 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAACAATATGGAGTATCAGAAGAAGAAGCTGTAACTGAACTACAAAAGCAAGTGGTTAATGCATGGAAAGATATAATTGAAGACTATATGAAATCCTCCAAGCTGTTTCCAAGTTTCATCCTTGACCATGTACTAAATGTTGCTCGACTTTCAGATCTCTTTTATAAGGAGGAAGATGGTTATACATTTGCTGATGGAGAAACCAAACGTTTTATTACGTTAATGCTTAAAAATCCTATGCCAATTTGA ATGAAACAATATGGAGTATCAGAAGAAGAAGCTGTAACTGAACTACAAAAGCAAGTGGTTAATGCATGGAAAGATATAATTGAAGACTATATGAAATCCTCCAAGCTGTTTCCAAGTTTCATCCTTGACCATGTACTAAATGTTGCTCGACTTTCAGATCTCTTTTATAAGGAGGAAGATGGTTATACATTTGCTGATGGAGAAACCAAACGTTTTATTACGTTAATGCTTAAAAATCCTATGCCAATTTGA ATGAAACAATATGGAGTATCAGAAGAAGAAGCTGTAACTGAACTACAAAAGCAAGTGGTTAATGCATGGAAAGATATAATTGAAGACTATATGAAATCCTCCAAGCTGTTTCCAAGTTTCATCCTTGACCATGTACTAAATGTTGCTCGACTTTCAGATCTCTTTTATAAGGAGGAAGATGGTTATACATTTGCTGATGGAGAAACCAAACGTTTTATTACGTTAATGCTTAAAAATCCTATGCCAATTTGA MKQYGVSEEEAVTELQKQVVNAWKDIIEDYMKSSKLFPSFILDHVLNVARLSDLFYKEEDGYTFADGETKRFITLMLKNPMPI* Homology
BLAST of Chy6G124760 vs. ExPASy Swiss-Prot
Match: B6SCF6 (Germacrene-A synthase OS=Humulus lupulus OX=3486 PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.2e-14 Identity = 42/82 (51.22%), Postives = 54/82 (65.85%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy Swiss-Prot
Match: B9SBV6 (Probable terpene synthase 3 OS=Ricinus communis OX=3988 GN=TPS3 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-13 Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy Swiss-Prot
Match: B6SCF5 (Alpha-humulene synthase OS=Humulus lupulus OX=3486 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.2e-13 Identity = 40/82 (48.78%), Postives = 52/82 (63.41%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy Swiss-Prot
Match: B5A435 (Sesquiterpene synthase OS=Santalum album OX=35974 PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.4e-13 Identity = 38/81 (46.91%), Postives = 53/81 (65.43%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy Swiss-Prot
Match: Q8LSC3 (Germacrene A synthase long form OS=Cichorium intybus OX=13427 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-12 Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy TrEMBL
Match: A0A0A0L5V3 (Terpene_synth_C domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G040860 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.6e-39 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy TrEMBL
Match: A0A6J1CQI9 ((-)-germacrene D synthase-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111013402 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 7.7e-26 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy TrEMBL
Match: A0A6J1CR35 ((-)-germacrene D synthase-like isoform X2 OS=Momordica charantia OX=3673 GN=LOC111013402 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 7.7e-26 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy TrEMBL
Match: A0A6J1CQI4 ((-)-germacrene D synthase-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111013399 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.5e-25 Identity = 57/83 (68.67%), Postives = 71/83 (85.54%), Query Frame = 0
BLAST of Chy6G124760 vs. ExPASy TrEMBL
Match: A0A6J1CR31 ((-)-germacrene D synthase-like isoform X2 OS=Momordica charantia OX=3673 GN=LOC111013399 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.5e-25 Identity = 57/83 (68.67%), Postives = 71/83 (85.54%), Query Frame = 0
BLAST of Chy6G124760 vs. NCBI nr
Match: XP_004151461.3 ((-)-germacrene D synthase [Cucumis sativus]) HSP 1 Score: 167 bits (424), Expect = 3.46e-47 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Chy6G124760 vs. NCBI nr
Match: KGN55986.2 (hypothetical protein Csa_011696 [Cucumis sativus]) HSP 1 Score: 167 bits (424), Expect = 6.40e-47 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Chy6G124760 vs. NCBI nr
Match: XP_038903578.1 (LOW QUALITY PROTEIN: (-)-germacrene D synthase-like [Benincasa hispida]) HSP 1 Score: 124 bits (312), Expect = 2.33e-31 Identity = 62/83 (74.70%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of Chy6G124760 vs. NCBI nr
Match: XP_022143532.1 ((-)-germacrene D synthase-like isoform X2 [Momordica charantia]) HSP 1 Score: 123 bits (309), Expect = 5.76e-31 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Chy6G124760 vs. NCBI nr
Match: XP_022143531.1 ((-)-germacrene D synthase-like isoform X1 [Momordica charantia]) HSP 1 Score: 123 bits (309), Expect = 1.02e-30 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Chy6G124760 vs. TAIR 10
Match: AT1G31950.1 (Terpenoid cyclases/Protein prenyltransferases superfamily protein ) HSP 1 Score: 73.6 bits (179), Expect = 8.7e-14 Identity = 35/83 (42.17%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Chy6G124760 vs. TAIR 10
Match: AT3G14540.1 (Terpenoid cyclases/Protein prenyltransferases superfamily protein ) HSP 1 Score: 70.1 bits (170), Expect = 9.7e-13 Identity = 34/83 (40.96%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of Chy6G124760 vs. TAIR 10
Match: AT3G14520.1 (Terpenoid cyclases/Protein prenyltransferases superfamily protein ) HSP 1 Score: 68.9 bits (167), Expect = 2.2e-12 Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of Chy6G124760 vs. TAIR 10
Match: AT3G29410.1 (Terpenoid cyclases/Protein prenyltransferases superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 2.8e-12 Identity = 35/83 (42.17%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of Chy6G124760 vs. TAIR 10
Match: AT1G70080.1 (Terpenoid cyclases/Protein prenyltransferases superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 4.1e-11 Identity = 34/73 (46.58%), Postives = 48/73 (65.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|