Chy2G044440 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCTGCTTGGCGTCGCCATAAGAAAAGGATGATGGCAAAAGACCTCTTAATAAAGGAATCGTTTACATTATCAGAACAAGTAGCTGATGAAACTACCCAAGGAGAGGAACAATTCTCTGTTGTTTCAAATCCTTCTCAGTCTAAAATGTATCTGGATGTAACCTTGCTGGCTTCAAGGTTTGCTGCAAACACAAGGAGAGGCGCCCAGAGAATGAAAGATGACTTGCCAAAATTACAAAAGCCCGATGAACCCGACTTTTCCATTGAGCCAGATAGATAA GCTGCTTGGCGTCGCCATAAGAAAAGGATGATGGCAAAAGACCTCTTAATAAAGGAATCGTTTACATTATCAGAACAAGTAGCTGATGAAACTACCCAAGGAGAGGAACAATTCTCTGTTGTTTCAAATCCTTCTCAGTCTAAAATGTATCTGGATGTAACCTTGCTGGCTTCAAGGTTTGCTGCAAACACAAGGAGAGGCGCCCAGAGAATGAAAGATGACTTGCCAAAATTACAAAAGCCCGATGAACCCGACTTTTCCATTGAGCCAGATAGATAA GCTGCTTGGCGTCGCCATAAGAAAAGGATGATGGCAAAAGACCTCTTAATAAAGGAATCGTTTACATTATCAGAACAAGTAGCTGATGAAACTACCCAAGGAGAGGAACAATTCTCTGTTGTTTCAAATCCTTCTCAGTCTAAAATGTATCTGGATGTAACCTTGCTGGCTTCAAGGTTTGCTGCAAACACAAGGAGAGGCGCCCAGAGAATGAAAGATGACTTGCCAAAATTACAAAAGCCCGATGAACCCGACTTTTCCATTGAGCCAGATAGATAA AAWRRHKKRMMAKDLLIKESFTLSEQVADETTQGEEQFSVVSNPSQSKMYLDVTLLASRFAANTRRGAQRMKDDLPKLQKPDEPDFSIEPDR* Homology
BLAST of Chy2G044440 vs. ExPASy Swiss-Prot
Match: Q8L7Z0 (Cyclic nucleotide-gated ion channel 17 OS=Arabidopsis thaliana OX=3702 GN=CNGC17 PE=1 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.5e-14 Identity = 50/95 (52.63%), Postives = 66/95 (69.47%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy Swiss-Prot
Match: Q9SJA4 (Probable cyclic nucleotide-gated ion channel 14 OS=Arabidopsis thaliana OX=3702 GN=CNGC14 PE=2 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 4.4e-11 Identity = 44/99 (44.44%), Postives = 61/99 (61.62%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy Swiss-Prot
Match: Q9LEQ3 (Cyclic nucleotide-gated ion channel 18 OS=Arabidopsis thaliana OX=3702 GN=CNGC18 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.7e-07 Identity = 42/111 (37.84%), Postives = 59/111 (53.15%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy Swiss-Prot
Match: Q9S9N5 (Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana OX=3702 GN=CNGC7 PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 4.0e-04 Identity = 35/95 (36.84%), Postives = 49/95 (51.58%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy Swiss-Prot
Match: Q9SU64 (Probable cyclic nucleotide-gated ion channel 16 OS=Arabidopsis thaliana OX=3702 GN=CNGC16 PE=2 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 8.9e-04 Identity = 36/103 (34.95%), Postives = 51/103 (49.51%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy TrEMBL
Match: A0A5D3BBU8 (Putative cyclic nucleotide-gated ion channel 17 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold271G00050 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.5e-42 Identity = 91/92 (98.91%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy TrEMBL
Match: A0A5A7SV37 (Putative cyclic nucleotide-gated ion channel 17 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold57G002180 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.5e-42 Identity = 91/92 (98.91%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy TrEMBL
Match: A0A1S3B9L5 (probable cyclic nucleotide-gated ion channel 17 OS=Cucumis melo OX=3656 GN=LOC103487299 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.5e-42 Identity = 91/92 (98.91%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy TrEMBL
Match: A0A0A0LZ73 (Cyclic nucleotide-binding domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G294610 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.5e-41 Identity = 90/92 (97.83%), Postives = 91/92 (98.91%), Query Frame = 0
BLAST of Chy2G044440 vs. ExPASy TrEMBL
Match: A0A6J1E670 (cyclic nucleotide-gated ion channel 17-like OS=Cucurbita moschata OX=3662 GN=LOC111429804 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 4.1e-36 Identity = 81/92 (88.04%), Postives = 87/92 (94.57%), Query Frame = 0
BLAST of Chy2G044440 vs. NCBI nr
Match: TYJ95945.1 (putative cyclic nucleotide-gated ion channel 17 [Cucumis melo var. makuwa]) HSP 1 Score: 178 bits (451), Expect = 5.28e-50 Identity = 91/92 (98.91%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Chy2G044440 vs. NCBI nr
Match: KAA0035134.1 (putative cyclic nucleotide-gated ion channel 17 [Cucumis melo var. makuwa]) HSP 1 Score: 178 bits (451), Expect = 5.38e-50 Identity = 91/92 (98.91%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Chy2G044440 vs. NCBI nr
Match: XP_008443796.1 (PREDICTED: probable cyclic nucleotide-gated ion channel 17 [Cucumis melo]) HSP 1 Score: 178 bits (451), Expect = 5.38e-50 Identity = 91/92 (98.91%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Chy2G044440 vs. NCBI nr
Match: KGN65281.1 (hypothetical protein Csa_019618 [Cucumis sativus]) HSP 1 Score: 176 bits (446), Expect = 2.74e-49 Identity = 90/92 (97.83%), Postives = 91/92 (98.91%), Query Frame = 0
BLAST of Chy2G044440 vs. NCBI nr
Match: XP_011656107.1 (cyclic nucleotide-gated ion channel 17 [Cucumis sativus]) HSP 1 Score: 176 bits (446), Expect = 5.00e-49 Identity = 90/92 (97.83%), Postives = 91/92 (98.91%), Query Frame = 0
BLAST of Chy2G044440 vs. TAIR 10
Match: AT4G30360.1 (cyclic nucleotide-gated channel 17 ) HSP 1 Score: 78.2 bits (191), Expect = 3.9e-15 Identity = 50/95 (52.63%), Postives = 66/95 (69.47%), Query Frame = 0
BLAST of Chy2G044440 vs. TAIR 10
Match: AT2G24610.1 (cyclic nucleotide-gated channel 14 ) HSP 1 Score: 68.6 bits (166), Expect = 3.1e-12 Identity = 44/99 (44.44%), Postives = 61/99 (61.62%), Query Frame = 0
BLAST of Chy2G044440 vs. TAIR 10
Match: AT5G14870.1 (cyclic nucleotide-gated channel 18 ) HSP 1 Score: 56.6 bits (135), Expect = 1.2e-08 Identity = 42/111 (37.84%), Postives = 59/111 (53.15%), Query Frame = 0
BLAST of Chy2G044440 vs. TAIR 10
Match: AT1G15990.1 (cyclic nucleotide gated channel 7 ) HSP 1 Score: 45.4 bits (106), Expect = 2.8e-05 Identity = 35/95 (36.84%), Postives = 49/95 (51.58%), Query Frame = 0
BLAST of Chy2G044440 vs. TAIR 10
Match: AT3G48010.1 (cyclic nucleotide-gated channel 16 ) HSP 1 Score: 44.3 bits (103), Expect = 6.3e-05 Identity = 36/103 (34.95%), Postives = 51/103 (49.51%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|