Chy2G037190 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCAAAAGAGGAGAAGCAAGAAGAAGAGCAAGAAAAACAACAACGACCCAGTTGAAGAACAAGAAGATCAAGAAGAACATCAAGAACAACAACATCAAGTTAGAAGAAGAAGAAATTGAAAAAGGTTCAAGTTCTTCAACAACCATTAATTTTGAAGAAAAACCAGTTTCAAGAAGAAGCTGTGATTTTGAAGAAGAAGAAGAAGAAGAAGAGTGTTGTAGTACTCCAAAAGCAGAGAGATTCAAAATCCCAGAAATCAAAATATGTCCACCAGCTCCTAAAAAGCGAAGGCTTTTTTCAAATTCAAATTCAAATTGTTCTTTACAAAGACCTTCTCCTATTGCTTTCTTTGCTTCACCAGATATAGAGCTTTTCTTCTTCTTCTCATCACAATGA ATGGCTTCCAAAAGAGGAGAAGCAAGAAGAAGAGCAAGAAAAACAACAACGACCCAGTTGAAGAACAAGAAGATCAAGAAGAACATCAAGAACAACAACATCAAGTTAGAAGAAGAAGAAATTGAAAAAGGTTCAAGTTCTTCAACAACCATTAATTTTGAAGAAAAACCAGTTTCAAGAAGAAGCTGTGATTTTGAAGAAGAAGAAGAAGAAGAAGAGTGTTGTAGTACTCCAAAAGCAGAGAGATTCAAAATCCCAGAAATCAAAATATGTCCACCAGCTCCTAAAAAGCGAAGGCTTTTTTCAAATTCAAATTCAAATTGTTCTTTACAAAGACCTTCTCCTATTGCTTTCTTTGCTTCACCAGATATAGAGCTTTTCTTCTTCTTCTCATCACAATGA ATGGCTTCCAAAAGAGGAGAAGCAAGAAGAAGAGCAAGAAAAACAACAACGACCCAGTTGAAGAACAAGAAGATCAAGAAGAACATCAAGAACAACAACATCAAGTTAGAAGAAGAAGAAATTGAAAAAGGTTCAAGTTCTTCAACAACCATTAATTTTGAAGAAAAACCAGTTTCAAGAAGAAGCTGTGATTTTGAAGAAGAAGAAGAAGAAGAAGAGTGTTGTAGTACTCCAAAAGCAGAGAGATTCAAAATCCCAGAAATCAAAATATGTCCACCAGCTCCTAAAAAGCGAAGGCTTTTTTCAAATTCAAATTCAAATTGTTCTTTACAAAGACCTTCTCCTATTGCTTTCTTTGCTTCACCAGATATAGAGCTTTTCTTCTTCTTCTCATCACAATGA MASKRGEARRRARKTTTTQLKNKKIKKNIKNNNIKLEEEEIEKGSSSSTTINFEEKPVSRRSCDFEEEEEEEECCSTPKAERFKIPEIKICPPAPKKRRLFSNSNSNCSLQRPSPIAFFASPDIELFFFFSSQ* Homology
BLAST of Chy2G037190 vs. ExPASy Swiss-Prot
Match: F4IWB3 (Cyclin-dependent protein kinase inhibitor SMR13 OS=Arabidopsis thaliana OX=3702 GN=SMR13 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 6.5e-08 Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy Swiss-Prot
Match: Q3ECS5 (Cyclin-dependent protein kinase inhibitor SMR9 OS=Arabidopsis thaliana OX=3702 GN=SMR9 PE=3 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 2.0e-04 Identity = 48/131 (36.64%), Postives = 66/131 (50.38%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy Swiss-Prot
Match: Q29Q81 (Cyclin-dependent protein kinase inhibitor SMR6 OS=Arabidopsis thaliana OX=3702 GN=SMR6 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 4.4e-04 Identity = 28/60 (46.67%), Postives = 34/60 (56.67%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy Swiss-Prot
Match: Q1G3Y4 (Cyclin-dependent protein kinase inhibitor SMR15 OS=Arabidopsis thaliana OX=3702 GN=SMR15 PE=3 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 9.8e-04 Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy TrEMBL
Match: A0A0A0M041 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G613590 PE=4 SV=1) HSP 1 Score: 245.7 bits (626), Expect = 1.1e-61 Identity = 131/133 (98.50%), Postives = 132/133 (99.25%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy TrEMBL
Match: A0A6J1DK32 (cyclin-dependent protein kinase inhibitor SMR9-like OS=Momordica charantia OX=3673 GN=LOC111021634 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 2.6e-15 Identity = 70/141 (49.65%), Postives = 87/141 (61.70%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy TrEMBL
Match: A0A7J9M5Q7 (Uncharacterized protein OS=Gossypium schwendimanii OX=34291 GN=Goshw_021036 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 4.1e-13 Identity = 57/130 (43.85%), Postives = 79/130 (60.77%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy TrEMBL
Match: A0A6M2EGF4 (Uncharacterized protein OS=Populus davidiana OX=266767 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 4.1e-13 Identity = 63/133 (47.37%), Postives = 80/133 (60.15%), Query Frame = 0
BLAST of Chy2G037190 vs. ExPASy TrEMBL
Match: B9GF02 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_001G257700 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.2e-12 Identity = 61/127 (48.03%), Postives = 79/127 (62.20%), Query Frame = 0
BLAST of Chy2G037190 vs. NCBI nr
Match: KGN66487.1 (hypothetical protein Csa_006949 [Cucumis sativus]) HSP 1 Score: 244 bits (622), Expect = 6.96e-81 Identity = 131/133 (98.50%), Postives = 132/133 (99.25%), Query Frame = 0
BLAST of Chy2G037190 vs. NCBI nr
Match: KAG6590203.1 (Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. sororia] >KAG7023854.1 Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 107 bits (267), Expect = 5.87e-27 Identity = 75/138 (54.35%), Postives = 92/138 (66.67%), Query Frame = 0
BLAST of Chy2G037190 vs. NCBI nr
Match: XP_022154348.1 (cyclin-dependent protein kinase inhibitor SMR9-like [Momordica charantia]) HSP 1 Score: 99.0 bits (245), Expect = 1.29e-23 Identity = 51/62 (82.26%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Chy2G037190 vs. NCBI nr
Match: KAG7022087.1 (Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 94.7 bits (234), Expect = 6.58e-22 Identity = 70/143 (48.95%), Postives = 84/143 (58.74%), Query Frame = 0
BLAST of Chy2G037190 vs. NCBI nr
Match: XP_023530358.1 (cyclin-dependent protein kinase inhibitor SMR9-like [Cucurbita pepo subsp. pepo] >KAG6588189.1 Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 94.4 bits (233), Expect = 9.58e-22 Identity = 70/144 (48.61%), Postives = 84/144 (58.33%), Query Frame = 0
BLAST of Chy2G037190 vs. TAIR 10
Match: AT3G20898.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G51355.1); Has 66 Blast hits to 66 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 66; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 58.5 bits (140), Expect = 4.6e-09 Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Chy2G037190 vs. TAIR 10
Match: AT1G51355.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G20898.1); Has 52 Blast hits to 52 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 47.0 bits (110), Expect = 1.4e-05 Identity = 48/131 (36.64%), Postives = 66/131 (50.38%), Query Frame = 0
BLAST of Chy2G037190 vs. TAIR 10
Match: AT5G40460.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G27630.1); Has 87 Blast hits to 87 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 87; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 45.8 bits (107), Expect = 3.1e-05 Identity = 28/60 (46.67%), Postives = 34/60 (56.67%), Query Frame = 0
BLAST of Chy2G037190 vs. TAIR 10
Match: AT1G60783.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G10690.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 44.7 bits (104), Expect = 6.9e-05 Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|