
Chy2G034480 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGAGCAAATCCCCAACCCTTGATTTCCTCACATTTGATCAGTTCTCTTTCTTGTGTCTATCGGTTCTTTCATCCGTATGAATCTGTTTGTGAATTGCGTGTATTCGTGCTTTTATCGATTTCAGGGAAAGTACACGGATCTCTGGCTCGTGCCGGTAAGGTGAGAGGTCAAACTCCAAAAGTAGCGAAGCAGGACAAGAAGAAGAAGCCCCGGGGACGTGCACACAAGCGGATGCAATACAATCGCAGATTCGTCACTGCAGGTAACATATTGTTGTTCAAATTATTTTGTTTTTCAGATGTTTTACCGGTTTAGCGCTGATGTTTTTGGTTTAACATTGTATTCAATCACTATTATAAGAAGTATGTTAATTGGTTTATTTGTTAGATTAGATGCAGTTCCTTATCAGAATAAATTGTTATTGCATTAGTAAGGTTTTTGTATCAGAGTACGATAAACATCATTCTGATGTGAGTTTAAATTTGTTTGATCTTTACAGTGGTTGGTTTTGGAAAGAAGAGAGGACCCAACTCATCTGAGAAGTAA ATGGGGAAAGTACACGGATCTCTGGCTCGTGCCGGTAAGGTGAGAGGTCAAACTCCAAAAGTAGCGAAGCAGGACAAGAAGAAGAAGCCCCGGGGACGTGCACACAAGCGGATGCAATACAATCGCAGATTCGTCACTGCAGTGGTTGGTTTTGGAAAGAAGAGAGGACCCAACTCATCTGAGAAGTAA ATGGGGAAAGTACACGGATCTCTGGCTCGTGCCGGTAAGGTGAGAGGTCAAACTCCAAAAGTAGCGAAGCAGGACAAGAAGAAGAAGCCCCGGGGACGTGCACACAAGCGGATGCAATACAATCGCAGATTCGTCACTGCAGTGGTTGGTTTTGGAAAGAAGAGAGGACCCAACTCATCTGAGAAGTAA MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK* Homology
BLAST of Chy2G034480 vs. ExPASy Swiss-Prot
Match: P49689 (40S ribosomal protein S30 OS=Arabidopsis thaliana OX=3702 GN=RPS30A PE=3 SV=3) HSP 1 Score: 120.6 bits (301), Expect = 6.6e-27 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy Swiss-Prot
Match: P62866 (40S ribosomal protein S30 OS=Bos taurus OX=9913 GN=FAU PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.3e-18 Identity = 46/58 (79.31%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy Swiss-Prot
Match: P62860 (40S ribosomal protein S30 OS=Cricetulus griseus OX=10029 GN=FAU PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.3e-18 Identity = 46/58 (79.31%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy Swiss-Prot
Match: P62861 (40S ribosomal protein S30 OS=Homo sapiens OX=9606 GN=FAU PE=1 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.3e-18 Identity = 46/58 (79.31%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy Swiss-Prot
Match: P62862 (40S ribosomal protein S30 OS=Mus musculus OX=10090 GN=Fau PE=1 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.3e-18 Identity = 46/58 (79.31%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy TrEMBL
Match: A0A368PSS0 (40S ribosomal protein S30 OS=Setaria italica OX=4555 GN=SETIT_1G356000v2 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy TrEMBL
Match: M5WRX6 (40S ribosomal protein S30 OS=Prunus persica OX=3760 GN=PRUPE_3G053900 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy TrEMBL
Match: A0A6J1KXK5 (40S ribosomal protein S30 OS=Cucurbita maxima OX=3661 GN=LOC111498467 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy TrEMBL
Match: A0A7I8KYK5 (40S ribosomal protein S30 OS=Spirodela intermedia OX=51605 GN=SI7747_09012508 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. ExPASy TrEMBL
Match: C5XV41 (40S ribosomal protein S30 OS=Sorghum bicolor OX=4558 GN=SORBI_3004G335600 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. NCBI nr
Match: WP_152932383.1 (30S ribosomal protein S30e [Escherichia coli] >NP_001356196.1 40S ribosomal protein S30-like [Zea mays] >XP_002281376.1 PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] >XP_002283033.1 PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] >XP_002318077.1 40S ribosomal protein S30 [Populus trichocarpa] >XP_002322202.1 40S ribosomal protein S30 [Populus trichocarpa] >XP_002436569.1 40S ribosomal protein S30 [Sorghum bicolor] >XP_002454730.1 40S ribosomal protein S30 [Sorghum bicolor] >XP_002514177.1 40S ribosomal protein S30 [Ricinus communis] >XP_002515895.1 40S ribosomal protein S30 [Ricinus communis] >XP_003517420.1 40S ribosomal protein S30 [Glycine max] >XP_003525848.1 40S ribosomal protein S30 [Glycine max] >XP_003538817.1 40S ribosomal protein S30 [Glycine max] >XP_004135684.1 40S ribosomal protein S30 [Cucumis sativus] >XP_004245996.2 40S ribosomal protein S30 [Solanum lycopersicum] >XP_004251654.1 40S ribosomal protein S30 [Solanum lycopersicum] >XP_004287748.1 PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] >XP_004297622.1 PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] >XP_004508905.1 40S ribosomal protein S30 [Cicer arietinum] >XP_004511685.1 40S ribosomal protein S30 [Cicer arietinum] >XP_006352915.1 PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] >XP_006353513.1 PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] >XP_006475373.1 40S ribosomal protein S30 [Citrus sinensis] >XP_006853921.1 40S ribosomal protein S30 [Amborella trichopoda] >XP_007024390.1 PREDICTED: 40S ribosomal protein S30 [Theobroma cacao] >XP_007155660.1 hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] >XP_007157355.1 hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] >XP_007215235.1 40S ribosomal protein S30 [Prunus persica] >XP_008241983.1 PREDICTED: 40S ribosomal protein S30 [Prunus mume] >XP_008244746.1 PREDICTED: 40S ribosomal protein S30 [Prunus mume] >XP_008450806.1 PREDICTED: 40S ribosomal protein S30 [Cucumis melo] >XP_008459180.1 PREDICTED: 40S ribosomal protein S30 [Cucumis melo] >XP_009588124.1 40S ribosomal protein S30 [Nicotiana tomentosiformis] >XP_009624349.1 40S ribosomal protein S30 [Nicotiana tomentosiformis] >XP_009626192.1 40S ribosomal protein S30 [Nicotiana tomentosiformis] >XP_009790332.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] >XP_009794298.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] >XP_010086894.2 40S ribosomal protein S30 [Morus notabilis] >XP_010267071.1 PREDICTED: 40S ribosomal protein S30 [Nelumbo nucifera] >XP_011014917.1 PREDICTED: 40S ribosomal protein S30 [Populus euphratica] >XP_011040498.1 PREDICTED: 40S ribosomal protein S30 [Populus euphratica] >XP_011085776.1 40S ribosomal protein S30 [Sesamum indicum] >XP_011093674.1 40S ribosomal protein S30 [Sesamum indicum] >XP_012076815.1 40S ribosomal protein S30 [Jatropha curcas] >XP_012831909.1 PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] >XP_012845561.1 PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] >XP_014507978.1 40S ribosomal protein S30 [Vigna radiata var. radiata] >XP_014520643.1 40S ribosomal protein S30 [Vigna radiata var. radiata] >XP_015059382.1 40S ribosomal protein S30 [Solanum pennellii] >XP_015083483.1 40S ribosomal protein S30 [Solanum pennellii] >XP_015623731.1 40S ribosomal protein S30 [Oryza sativa Japonica Group] >XP_015644441.1 40S ribosomal protein S30 [Oryza sativa Japonica Group] >XP_015866631.1 40S ribosomal protein S30 [Ziziphus jujuba] >XP_015962015.1 40S ribosomal protein S30 [Arachis duranensis] >XP_015964426.1 40S ribosomal protein S30 [Arachis duranensis] >XP_016188282.1 40S ribosomal protein S30 [Arachis ipaensis] >XP_016200666.1 40S ribosomal protein S30 [Arachis ipaensis] >XP_016438944.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] >XP_016474572.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] >XP_016480718.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] >XP_016485434.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] >XP_016507476.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] >XP_016571468.1 PREDICTED: 40S ribosomal protein S30 [Capsicum annuum] >XP_017235880.1 PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] >XP_017240313.1 PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] >XP_017426528.1 PREDICTED: 40S ribosomal protein S30 [Vigna angularis] >XP_017428506.1 PREDICTED: 40S ribosomal protein S30 [Vigna angularis] >XP_018809943.1 40S ribosomal protein S30 [Juglans regia] >XP_018843304.1 40S ribosomal protein S30 [Juglans regia] >XP_018843305.1 40S ribosomal protein S30 [Juglans regia] >XP_019056958.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] >XP_019058004.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] >XP_019058091.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] >XP_019058590.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] >XP_019246883.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] >XP_019249645.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] >XP_019254765.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] >XP_020217589.1 40S ribosomal protein S30 [Cajanus cajan] >XP_020228315.1 40S ribosomal protein S30 [Cajanus cajan] >XP_020395077.1 40S ribosomal protein S30 [Zea mays] >XP_020423287.1 40S ribosomal protein S30 [Prunus persica] >XP_020690072.1 40S ribosomal protein S30 [Dendrobium catenatum] >XP_021819535.1 40S ribosomal protein S30 [Prunus avium] >XP_021829647.1 40S ribosomal protein S30 [Prunus avium] >XP_021897725.1 40S ribosomal protein S30 [Carica papaya] >XP_022144845.1 40S ribosomal protein S30 [Momordica charantia] >XP_022154651.1 40S ribosomal protein S30 [Momordica charantia] >XP_022842567.1 40S ribosomal protein S30 [Olea europaea var. sylvestris] >XP_022847148.1 40S ribosomal protein S30 [Olea europaea var. sylvestris] >XP_022933835.1 40S ribosomal protein S30 [Cucurbita moschata] >XP_022946111.1 40S ribosomal protein S30 [Cucurbita moschata] >XP_022961013.1 40S ribosomal protein S30 [Cucurbita moschata] >XP_022987920.1 40S ribosomal protein S30 [Cucurbita maxima] >XP_022999552.1 40S ribosomal protein S30 [Cucurbita maxima] >XP_023005505.1 40S ribosomal protein S30 [Cucurbita maxima] >XP_023531276.1 40S ribosomal protein S30 [Cucurbita pepo subsp. pepo] >XP_023546616.1 40S ribosomal protein S30 [Cucurbita pepo subsp. pepo] >XP_023547013.1 40S ribosomal protein S30 [Cucurbita pepo subsp. pepo] >XP_023870362.1 40S ribosomal protein S30 [Quercus suber] >XP_023926964.1 40S ribosomal protein S30 [Quercus suber] >XP_024033800.1 40S ribosomal protein S30 [Citrus clementina] >XP_024183670.1 40S ribosomal protein S30 [Rosa chinensis] >XP_024184511.1 40S ribosomal protein S30 [Rosa chinensis] >XP_024440441.1 40S ribosomal protein S30 [Populus trichocarpa] >XP_025627684.1 40S ribosomal protein S30 [Arachis hypogaea] >XP_025653703.1 40S ribosomal protein S30 [Arachis hypogaea] >XP_025700088.1 40S ribosomal protein S30 [Arachis hypogaea] >XP_025701787.1 40S ribosomal protein S30 [Arachis hypogaea] >XP_025812093.1 40S ribosomal protein S30-like [Panicum hallii] >XP_025812513.1 40S ribosomal protein S30-like [Panicum hallii] >XP_026399931.1 40S ribosomal protein S30 [Papaver somniferum] >XP_026412805.1 40S ribosomal protein S30 [Papaver somniferum] >XP_026423634.1 40S ribosomal protein S30 [Papaver somniferum] >XP_026444593.1 40S ribosomal protein S30 [Papaver somniferum] >XP_027063443.1 40S ribosomal protein S30 [Coffea arabica] >XP_027069546.1 40S ribosomal protein S30 [Coffea arabica] >XP_027127448.1 40S ribosomal protein S30 [Coffea arabica] >XP_027176122.1 40S ribosomal protein S30 [Coffea eugenioides] >XP_027185013.1 40S ribosomal protein S30 [Coffea eugenioides] >XP_027337595.1 40S ribosomal protein S30 [Abrus precatorius] >XP_027362061.1 40S ribosomal protein S30 [Abrus precatorius] >XP_027912251.1 40S ribosomal protein S30 [Vigna unguiculata] >XP_027918131.1 40S ribosomal protein S30 [Vigna unguiculata] >XP_028071190.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028113710.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028113711.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028113712.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028113713.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028113714.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028117449.1 40S ribosomal protein S30 [Camellia sinensis] >XP_028188010.1 40S ribosomal protein S30 [Glycine soja] >XP_028209499.1 40S ribosomal protein S30 [Glycine soja] >XP_028231765.1 40S ribosomal protein S30 [Glycine soja] >XP_028246415.1 40S ribosomal protein S30 [Glycine soja] >XP_028770207.1 40S ribosomal protein S30 [Prosopis alba] >XP_028785750.1 40S ribosomal protein S30 [Prosopis alba] >XP_030448763.1 40S ribosomal protein S30 [Syzygium oleosum] >XP_030465217.1 40S ribosomal protein S30 [Syzygium oleosum] >XP_030491460.1 40S ribosomal protein S30 [Cannabis sativa] >XP_030505992.1 40S ribosomal protein S30 [Cannabis sativa] >XP_030541765.1 40S ribosomal protein S30 [Rhodamnia argentea] >XP_030953239.1 40S ribosomal protein S30 [Quercus lobata] >XP_030962649.1 40S ribosomal protein S30 [Quercus lobata] >XP_030971023.1 40S ribosomal protein S30 [Quercus lobata] >XP_031252239.1 40S ribosomal protein S30 [Pistacia vera] >XP_031258071.1 40S ribosomal protein S30 [Pistacia vera] >XP_031268678.1 40S ribosomal protein S30 [Pistacia vera] >XP_031384673.1 40S ribosomal protein S30 [Punica granatum] >XP_031395284.1 40S ribosomal protein S30 [Punica granatum] >XP_031481066.1 40S ribosomal protein S30 [Nymphaea colorata] >XP_034208982.1 40S ribosomal protein S30 [Prunus dulcis] >XP_034224868.1 40S ribosomal protein S30 [Prunus dulcis] >XP_034695492.1 40S ribosomal protein S30 [Vitis riparia] >XP_034700069.1 40S ribosomal protein S30 [Vitis riparia] >XP_034700154.1 40S ribosomal protein S30 [Vitis riparia] >XP_034903791.1 40S ribosomal protein S30 [Populus alba] >XP_034909171.1 40S ribosomal protein S30 [Populus alba] >XP_034925888.1 40S ribosomal protein S30 [Populus alba] >XP_038696715.1 40S ribosomal protein S30 [Tripterygium wilfordii] >XP_038698432.1 40S ribosomal protein S30 [Tripterygium wilfordii] >XP_038710650.1 40S ribosomal protein S30 [Tripterygium wilfordii] >XP_038878755.1 40S ribosomal protein S30 [Benincasa hispida] >XP_038890603.1 40S ribosomal protein S30 [Benincasa hispida] >XP_039116326.1 40S ribosomal protein S30 [Dioscorea cayenensis subsp. rotundata] >XP_039122716.1 40S ribosomal protein S30 [Dioscorea cayenensis subsp. rotundata] >XP_039164399.1 40S ribosomal protein S30 [Eucalyptus grandis] >XP_039165969.1 40S ribosomal protein S30 [Eucalyptus grandis] >XP_039842620.1 40S ribosomal protein S30 [Panicum virgatum] >XP_040867141.1 40S ribosomal protein S30 [Glycine max] >XP_041001441.1 40S ribosomal protein S30 [Juglans microcarpa x Juglans regia] >XP_041001442.1 40S ribosomal protein S30 [Juglans microcarpa x Juglans regia] >XP_041001443.1 40S ribosomal protein S30 [Juglans microcarpa x Juglans regia] >XP_041006731.1 40S ribosomal protein S30 [Juglans microcarpa x Juglans regia] >XP_041006732.1 40S ribosomal protein S30 [Juglans microcarpa x Juglans regia] >XP_042391665.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042397043.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042402011.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042405602.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042414104.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042460795.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042466378.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042471153.1 40S ribosomal protein S30 [Zingiber officinale] >XP_042967963.1 40S ribosomal protein S30 isoform X2 [Carya illinoinensis] >XP_042967967.1 40S ribosomal protein S30 [Carya illinoinensis] >XP_042975401.1 40S ribosomal protein S30 [Carya illinoinensis] >XP_042977202.1 40S ribosomal protein S30 [Carya illinoinensis] >4V3P_SZ Chain SZ, 40S ribosomal protein S30 [Triticum aestivum] >4V7E_Be Chain Be, 40S ribosomal protein S30E [Triticum aestivum] >AFK44345.1 unknown [Lotus japonicus] >AHY23246.1 hypothetical protein [Fallopia multiflora] >KAB8089385.1 hypothetical protein EE612_014306 [Oryza sativa] >KAE9597453.1 putative ribosomal protein S30 [Lupinus albus] >KAF3450645.1 hypothetical protein FNV43_RR06734 [Rhamnella rubrinervis] >KAF3782808.1 40S ribosomal protein S30 [Nymphaea thermarum] >KAF7147518.1 hypothetical protein RHSIM_Rhsim03G0235100 [Rhododendron simsii] >KAF7833512.1 40S ribosomal protein S30 [Senna tora] >KAF8036398.1 hypothetical protein BT93_C2187 [Corymbia citriodora subsp. variegata] >KAF8400953.1 hypothetical protein HHK36_014256 [Tetracentron sinense] >KAG5230220.1 hypothetical protein IMY05_015G0077700 [Salix suchowensis] >KAG5592503.1 hypothetical protein H5410_043017 [Solanum commersonii] >KAG7023631.1 40S ribosomal protein S30 [Cucurbita argyrosperma subsp. argyrosperma] >KAG8367292.1 hypothetical protein BUALT_Bualt16G0057200 [Buddleja alternifolia] >OVA11728.1 Ribosomal protein S30 [Macleaya cordata] >PIN21731.1 Ubiquitin-like/40S ribosomal S30 protein fusion [Handroanthus impetiginosus] >PNX77408.1 40S ribosomal protein s30-like [Trifolium pratense] >PON62506.1 Ribosomal protein [Parasponia andersonii] >POO00600.1 Ribosomal protein [Trema orientale] >PUZ60266.1 hypothetical protein GQ55_4G110000 [Panicum hallii var. hallii] >RAL51104.1 hypothetical protein DM860_005460 [Cuscuta australis] >RCV08805.1 hypothetical protein SETIT_1G356000v2 [Setaria italica] >RDX87141.1 40S ribosomal protein S30 [Mucuna pruriens] >RLM55183.1 hypothetical protein C2845_PM10G14730 [Panicum miliaceum] >TKW19971.1 hypothetical protein SEVIR_4G055000v2 [Setaria viridis] >TMW91449.1 hypothetical protein EJD97_014332 [Solanum chilense] >TVU07908.1 hypothetical protein EJB05_41285 [Eragrostis curvula] >TYK10130.1 40S ribosomal protein S30-like [Cucumis melo var. makuwa] >CAA2626821.1 unnamed protein product [Spirodela intermedia] >CAB3448242.1 unnamed protein product [Digitaria exilis] >CAB4287902.1 unnamed protein product [Prunus armeniaca] >CAD6337521.1 unnamed protein product [Miscanthus lutarioriparius] >GAU24499.1 hypothetical protein TSUD_156110 [Trifolium subterraneum]) HSP 1 Score: 123 bits (308), Expect = 3.34e-35 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. NCBI nr
Match: XP_006858925.1 (40S ribosomal protein S30 [Amborella trichopoda] >ERN20392.1 hypothetical protein AMTR_s00068p00064720 [Amborella trichopoda]) HSP 1 Score: 122 bits (307), Expect = 4.74e-35 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. NCBI nr
Match: PIA42862.1 (hypothetical protein AQUCO_02000366v1, partial [Aquilegia coerulea]) HSP 1 Score: 123 bits (308), Expect = 5.99e-35 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. NCBI nr
Match: KAG6536252.1 (hypothetical protein ZIOFF_001303 [Zingiber officinale]) HSP 1 Score: 123 bits (308), Expect = 6.34e-35 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. NCBI nr
Match: KAG6402186.1 (hypothetical protein SASPL_139061 [Salvia splendens]) HSP 1 Score: 123 bits (308), Expect = 6.53e-35 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. TAIR 10
Match: AT2G19750.1 (Ribosomal protein S30 family protein ) HSP 1 Score: 120.6 bits (301), Expect = 4.7e-28 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. TAIR 10
Match: AT4G29390.1 (Ribosomal protein S30 family protein ) HSP 1 Score: 120.6 bits (301), Expect = 4.7e-28 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of Chy2G034480 vs. TAIR 10
Match: AT5G56670.1 (Ribosomal protein S30 family protein ) HSP 1 Score: 120.6 bits (301), Expect = 4.7e-28 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|