![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Chy2G033570 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTACTCCTCTGGGGTCTTATGGTCCATGTGACGATTCGGCTGCCCCATACGTAAAAGAAATTGCAGAACGGGCAGTAGCTGATCACAACAATTCAGCAGGAACAAATTACACACTCGTTTCCATCGTCAAGTGTGAGTCCGCGGTTGTATCCGGAACCAACTACCGCCTTGTACTGTCGCTTAAGGATGACAGTACTACCGGTGATTTCTTGGTAGTTGTGTATTATAGGCCATGGGATGATTACCTGGAGGTCACTCAGTTTGAACCTGTCACGAAATAAATTGCAACATCCCATCTACTACTACTTATATATATACGTATGTATGAGCTATCTATATAAGTAATGGAACATACATTTTAAATAAAGCTATTATGTGTGTGTTTTTGTATTTTTTTCATCTCACTGTTGTGGGCATGTTTAGTAGTTTTTTTCTTTTTTCTTTTAAAGCGGTGCGACACGAGGATTTCTCATCTAAGGAAGCTTAGACTATGTGAGTTTTGATGGAATTTAGTGTGAATTAGTGCAGGTATAATCGTGCCACAAAATATATAGTTTGGTCTTTTTATATGAGAAATGAAATATGTAAATCTCACTGTACTTGTGGCTGCAGGTCGAATGTATCAATTGA ATGTGTACTCCTCTGGGGTCTTATGGTCCATGTGACGATTCGGCTGCCCCATACGTAAAAGAAATTGCAGAACGGGCAGTAGCTGATCACAACAATTCAGCAGGAACAAATTACACACTCGTTTCCATCGTCAAGTGTGAGTCCGCGGTTGTATCCGGAACCAACTACCGCCTTGTACTGTCGCTTAAGGATGACAGTACTACCGGTGATTTCTTGGTAGTTGTGTATTATAGGCCATGGGATGATTACCTGGAGGTCGAATGTATCAATTGA ATGTGTACTCCTCTGGGGTCTTATGGTCCATGTGACGATTCGGCTGCCCCATACGTAAAAGAAATTGCAGAACGGGCAGTAGCTGATCACAACAATTCAGCAGGAACAAATTACACACTCGTTTCCATCGTCAAGTGTGAGTCCGCGGTTGTATCCGGAACCAACTACCGCCTTGTACTGTCGCTTAAGGATGACAGTACTACCGGTGATTTCTTGGTAGTTGTGTATTATAGGCCATGGGATGATTACCTGGAGGTCGAATGTATCAATTGA MCTPLGSYGPCDDSAAPYVKEIAERAVADHNNSAGTNYTLVSIVKCESAVVSGTNYRLVLSLKDDSTTGDFLVVVYYRPWDDYLEVECIN* Homology
BLAST of Chy2G033570 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 1.2e-08 Identity = 27/75 (36.00%), Postives = 48/75 (64.00%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.5e-08 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-07 Identity = 27/77 (35.06%), Postives = 46/77 (59.74%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.0e-05 Identity = 25/77 (32.47%), Postives = 39/77 (50.65%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy Swiss-Prot
Match: P31726 (Cystatin-1 OS=Zea mays OX=4577 GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 5.1e-04 Identity = 20/69 (28.99%), Postives = 39/69 (56.52%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy TrEMBL
Match: A0A0A0KKN2 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G476020 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 7.3e-38 Identity = 79/86 (91.86%), Postives = 80/86 (93.02%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy TrEMBL
Match: A0A5A7SH83 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G002010 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 4.3e-30 Identity = 62/86 (72.09%), Postives = 73/86 (84.88%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy TrEMBL
Match: O80389 (Cystein proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 8.1e-13 Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy TrEMBL
Match: A0A6A4PE35 (Putative Cystatin domain-containing protein OS=Lupinus albus OX=3870 GN=Lalb_Chr15g0088031 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.8e-12 Identity = 40/79 (50.63%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of Chy2G033570 vs. ExPASy TrEMBL
Match: A0A6A5PD78 (Cystatin domain-containing protein OS=Lupinus albus OX=3870 GN=Lal_00043990 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.8e-12 Identity = 40/79 (50.63%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of Chy2G033570 vs. NCBI nr
Match: KAE8645939.1 (hypothetical protein Csa_021371 [Cucumis sativus] >KAE8647439.1 hypothetical protein Csa_004102 [Cucumis sativus]) HSP 1 Score: 177 bits (449), Expect = 7.29e-56 Identity = 83/90 (92.22%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Chy2G033570 vs. NCBI nr
Match: KAA0025196.1 (Cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa] >TYK07470.1 Cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 141 bits (356), Expect = 1.27e-41 Identity = 62/86 (72.09%), Postives = 73/86 (84.88%), Query Frame = 0
BLAST of Chy2G033570 vs. NCBI nr
Match: NP_001267677.1 (cysteine proteinase inhibitor 5-like [Cucumis sativus] >BAA28867.1 cystein proteinase inhibitor [Cucumis sativus]) HSP 1 Score: 84.0 bits (206), Expect = 9.29e-19 Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 0
BLAST of Chy2G033570 vs. NCBI nr
Match: KAF1895344.1 (hypothetical protein Lal_00043990 [Lupinus albus]) HSP 1 Score: 82.8 bits (203), Expect = 2.58e-18 Identity = 40/79 (50.63%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of Chy2G033570 vs. NCBI nr
Match: KAE9599108.1 (putative Cystatin domain-containing protein [Lupinus albus]) HSP 1 Score: 82.8 bits (203), Expect = 4.18e-18 Identity = 40/79 (50.63%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of Chy2G033570 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 27/77 (35.06%), Postives = 46/77 (59.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|