Chy2G033440 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GATCCACAAGATCCAAAAGTGAAAGGAATAGCAGAATGGGCAGTGGAAGAATACAACAAAGGAGGCCATAGCTTGACCCATGTAAGTATATTGAAATGTGAGTATCAAGTGGTGAGTGGAATCAATTGGCGTCTTAAATTGAAGTGTGTAGATCAAAACAATTGTGAGGGAGTCTATGAGACTGTTGTGTGGGAGAAATTGGACGGAAGCCTGGTGCTTAGTTACTTCGTTCATCTCTTGACATGA GATCCACAAGATCCAAAAGTGAAAGGAATAGCAGAATGGGCAGTGGAAGAATACAACAAAGGAGGCCATAGCTTGACCCATGTAAGTATATTGAAATGTGAGTATCAAGTGGTGAGTGGAATCAATTGGCGTCTTAAATTGAAGTGTGTAGATCAAAACAATTGTGAGGGAGTCTATGAGACTGTTGTGTGGGAGAAATTGGACGGAAGCCTGGTGCTTAGTTACTTCGTTCATCTCTTGACATGA GATCCACAAGATCCAAAAGTGAAAGGAATAGCAGAATGGGCAGTGGAAGAATACAACAAAGGAGGCCATAGCTTGACCCATGTAAGTATATTGAAATGTGAGTATCAAGTGGTGAGTGGAATCAATTGGCGTCTTAAATTGAAGTGTGTAGATCAAAACAATTGTGAGGGAGTCTATGAGACTGTTGTGTGGGAGAAATTGGACGGAAGCCTGGTGCTTAGTTACTTCGTTCATCTCTTGACATGA DPQDPKVKGIAEWAVEEYNKGGHSLTHVSILKCEYQVVSGINWRLKLKCVDQNNCEGVYETVVWEKLDGSLVLSYFVHLLT* Homology
BLAST of Chy2G033440 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-06 Identity = 28/64 (43.75%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 2.4e-05 Identity = 26/68 (38.24%), Postives = 38/68 (55.88%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 44.3 bits (103), Expect = 7.8e-04 Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 7.8e-04 Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy TrEMBL
Match: A0A0A0KHN6 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G482230 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 2.4e-24 Identity = 62/81 (76.54%), Postives = 65/81 (80.25%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy TrEMBL
Match: O80389 (Cystein proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.9e-21 Identity = 57/83 (68.67%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy TrEMBL
Match: A0A5A7TBL3 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold529G00310 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 2.2e-17 Identity = 48/82 (58.54%), Postives = 56/82 (68.29%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy TrEMBL
Match: A0A5A7TGL3 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold529G00530 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 7.3e-13 Identity = 45/83 (54.22%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Chy2G033440 vs. ExPASy TrEMBL
Match: A0A5A7SLP1 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold541G00100 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 3.6e-12 Identity = 44/83 (53.01%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Chy2G033440 vs. NCBI nr
Match: KAE8647451.1 (hypothetical protein Csa_002769 [Cucumis sativus]) HSP 1 Score: 112 bits (281), Expect = 1.82e-29 Identity = 56/75 (74.67%), Postives = 60/75 (80.00%), Query Frame = 0
BLAST of Chy2G033440 vs. NCBI nr
Match: NP_001267677.1 (cysteine proteinase inhibitor 5-like [Cucumis sativus] >BAA28867.1 cystein proteinase inhibitor [Cucumis sativus]) HSP 1 Score: 110 bits (275), Expect = 2.07e-29 Identity = 57/83 (68.67%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Chy2G033440 vs. NCBI nr
Match: KAE8647756.1 (hypothetical protein Csa_003034 [Cucumis sativus]) HSP 1 Score: 110 bits (275), Expect = 4.00e-27 Identity = 57/83 (68.67%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Chy2G033440 vs. NCBI nr
Match: KAA0040710.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 97.1 bits (240), Expect = 4.18e-24 Identity = 48/82 (58.54%), Postives = 56/82 (68.29%), Query Frame = 0
BLAST of Chy2G033440 vs. NCBI nr
Match: KAA0040727.1 (cysteine proteinase inhibitor 5-like [Cucumis melo var. makuwa]) HSP 1 Score: 82.0 bits (201), Expect = 3.98e-18 Identity = 45/83 (54.22%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Chy2G033440 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 52.8 bits (125), Expect = 1.6e-07 Identity = 28/64 (43.75%), Postives = 38/64 (59.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|