Chy12G213600 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAGATTCAATACTCTGAGAAGTACTTTGATGATATCTATGAGTATAGGTCTGCGATTTCTCTTCGATTCATGATGTTTTTTTCATTGCCATGGTTTGATTCTCATGGGTTTTTTTTTTTTTTTTTGTTGATGTTTGTTATAGGCATGTGGTGCTTACTCCTGAAGTGGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAGTAAGTATTTCGTGATTCTTCTCTATAATCATTATTTCTTGTGTCGAATCCTGTTCTGATAATCGGAAACGAACTAAATTGGAAGTGGAAGAGATCTCTCTCATAAGCATCGGCTGCTTTAATGTGATTGTGCGATATAATCTGAATACACTTGAGATCTGTGTAGTTTGATTATGCAATAGATTGATTGCGTGATGATTAATCTGAAGTAAATATTTCACGATTCTCCTCTATATCATAATTTCTTGTGTGAAATCCTGTTCCGCTAACTGAAAAGAAAATGAACTAAAAGTTGAAAGAGATCTCTTTCATAATCTGAATATCTTTCAGTTGAAGTAATGGAATTTGATGTTGATGATGAACAGAATGAATGGAGAGCGATCGGTGTTCAACAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCACACATAATGTTGTTCAGAAGGCCACTCAACTATCAACAGCAGCAAGAGAATCAAGCACAACAGCAGATTTTGGCCAAGTAA ATGGGTCAGATTCAATACTCTGAGAAGTACTTTGATGATATCTATGAGTATAGGCATGTGGTGCTTACTCCTGAAGTGGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGAGAGCGATCGGTGTTCAACAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCACACATAATGTTGTTCAGAAGGCCACTCAACTATCAACAGCAGCAAGAGAATCAAGCACAACAGCAGATTTTGGCCAAGTAA ATGGGTCAGATTCAATACTCTGAGAAGTACTTTGATGATATCTATGAGTATAGGCATGTGGTGCTTACTCCTGAAGTGGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGAGAGCGATCGGTGTTCAACAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCACACATAATGTTGTTCAGAAGGCCACTCAACTATCAACAGCAGCAAGAGAATCAAGCACAACAGCAGATTTTGGCCAAGTAA MGQIQYSEKYFDDIYEYRHVVLTPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQQILAK* Homology
BLAST of Chy12G213600 vs. ExPASy Swiss-Prot
Match: O23249 (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 3.0e-41 Identity = 78/86 (90.70%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy Swiss-Prot
Match: A2XCH8 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.6e-39 Identity = 76/81 (93.83%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy Swiss-Prot
Match: Q6PS57 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.6e-39 Identity = 76/81 (93.83%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy Swiss-Prot
Match: Q9SJJ5 (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 7.6e-37 Identity = 70/80 (87.50%), Postives = 76/80 (95.00%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy Swiss-Prot
Match: P55933 (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.2e-27 Identity = 52/66 (78.79%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy TrEMBL
Match: A0A0A0LY04 (Cyclin-dependent kinases regulatory subunit OS=Cucumis sativus OX=3659 GN=Csa_1G132710 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 2.5e-43 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy TrEMBL
Match: A0A1S4E4W6 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103500769 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 2.5e-43 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy TrEMBL
Match: A0A6J1I3M7 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita maxima OX=3661 GN=LOC111469347 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 5.6e-43 Identity = 87/88 (98.86%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy TrEMBL
Match: A0A6J1HM34 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita moschata OX=3662 GN=LOC111464859 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 5.6e-43 Identity = 87/88 (98.86%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. ExPASy TrEMBL
Match: A0A1S4E453 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103500769 PE=3 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 7.4e-43 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. NCBI nr
Match: XP_011654109.1 (cyclin-dependent kinases regulatory subunit 1 [Cucumis sativus] >XP_016903015.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 isoform X2 [Cucumis melo] >KGN64861.1 hypothetical protein Csa_022815 [Cucumis sativus]) HSP 1 Score: 183 bits (464), Expect = 3.24e-58 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. NCBI nr
Match: XP_022964884.1 (cyclin-dependent kinases regulatory subunit 1-like [Cucurbita moschata] >XP_022964885.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita moschata] >XP_022970358.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita maxima] >XP_022970359.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita maxima] >XP_023519916.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita pepo subsp. pepo] >XP_023519917.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita pepo subsp. pepo] >KAG6583592.1 Cyclin-dependent kinases regulatory subunit 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7019293.1 Cyclin-dependent kinases regulatory subunit 2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 182 bits (461), Expect = 9.30e-58 Identity = 87/88 (98.86%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. NCBI nr
Match: XP_016903011.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1 isoform X1 [Cucumis melo]) HSP 1 Score: 181 bits (460), Expect = 1.92e-57 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Chy12G213600 vs. NCBI nr
Match: XP_038894383.1 (cyclin-dependent kinases regulatory subunit 1 [Benincasa hispida]) HSP 1 Score: 181 bits (458), Expect = 2.67e-57 Identity = 87/88 (98.86%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Chy12G213600 vs. NCBI nr
Match: GAV69670.1 (CKS domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 178 bits (451), Expect = 3.12e-56 Identity = 85/88 (96.59%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Chy12G213600 vs. TAIR 10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1 ) HSP 1 Score: 168.7 bits (426), Expect = 2.1e-42 Identity = 78/86 (90.70%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of Chy12G213600 vs. TAIR 10
Match: AT2G27970.1 (CDK-subunit 2 ) HSP 1 Score: 154.1 bits (388), Expect = 5.4e-38 Identity = 70/80 (87.50%), Postives = 76/80 (95.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|