![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Chy10G174210 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAGAAAAGATTGTTTTTCCTTCAGGTTAGAAAGGCTCCTTCCCAGTTTGGGATTTCTCTTCTTAAAACTTTGAATCATTATTAGTCTTTTATAATTGAATTCAATTTACGTAGGTAAATCGTCGTGGCCGGAACTCGTATTCGTGAAATCTTCGGTTGCAGTGCATTTGATAGAAAGAGATCGGCCTGATGTGAAGCCAATTGTGCTGTTAGCTGGATCTCCCGTTACCGAAGATTTAAGGCCAAATCGAGTTCGTATTTTTGTTAATATGAACAATAAGGTTGTTGAAGTTCCTAGAACTGGTTGA ATGGCTGAAGAAAAGATTGTTTTTCCTTCAGGTAAATCGTCGTGGCCGGAACTCGTATTCGTGAAATCTTCGGTTGCAGTGCATTTGATAGAAAGAGATCGGCCTGATGTGAAGCCAATTGTGCTGTTAGCTGGATCTCCCGTTACCGAAGATTTAAGGCCAAATCGAGTTCGTATTTTTGTTAATATGAACAATAAGGTTGTTGAAGTTCCTAGAACTGGTTGA ATGGCTGAAGAAAAGATTGTTTTTCCTTCAGGTAAATCGTCGTGGCCGGAACTCGTATTCGTGAAATCTTCGGTTGCAGTGCATTTGATAGAAAGAGATCGGCCTGATGTGAAGCCAATTGTGCTGTTAGCTGGATCTCCCGTTACCGAAGATTTAAGGCCAAATCGAGTTCGTATTTTTGTTAATATGAACAATAAGGTTGTTGAAGTTCCTAGAACTGGTTGA MAEEKIVFPSGKSSWPELVFVKSSVAVHLIERDRPDVKPIVLLAGSPVTEDLRPNRVRIFVNMNNKVVEVPRTG* Homology
BLAST of Chy10G174210 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-12 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.5e-09 Identity = 29/63 (46.03%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-09 Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy Swiss-Prot
Match: Q03199 (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-08 Identity = 28/64 (43.75%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.8e-08 Identity = 27/64 (42.19%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy TrEMBL
Match: A0A0A0KPI0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G027950 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 6.0e-30 Identity = 70/75 (93.33%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy TrEMBL
Match: A0A6J1CY53 (inhibitor of trypsin and hageman factor-like OS=Momordica charantia OX=3673 GN=LOC111015335 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 3.7e-11 Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy TrEMBL
Match: A0A0A0KME7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.1e-10 Identity = 36/69 (52.17%), Postives = 54/69 (78.26%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy TrEMBL
Match: A0A0M3SAG8 (Serine proteinase inhibitor OS=Cucumis metulifer OX=61886 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.8e-10 Identity = 35/69 (50.72%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Chy10G174210 vs. ExPASy TrEMBL
Match: A0A6J1IK14 (inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 GN=LOC111474422 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 2.4e-10 Identity = 37/64 (57.81%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of Chy10G174210 vs. NCBI nr
Match: XP_011654473.1 (inhibitor of trypsin and hageman factor [Cucumis sativus] >KGN49621.1 hypothetical protein Csa_018430 [Cucumis sativus]) HSP 1 Score: 140 bits (353), Expect = 1.07e-41 Identity = 70/75 (93.33%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of Chy10G174210 vs. NCBI nr
Match: XP_022146026.1 (inhibitor of trypsin and hageman factor-like [Momordica charantia]) HSP 1 Score: 78.2 bits (191), Expect = 6.04e-17 Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of Chy10G174210 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_004718 [Cucumis sativus]) HSP 1 Score: 76.6 bits (187), Expect = 2.04e-16 Identity = 36/69 (52.17%), Postives = 54/69 (78.26%), Query Frame = 0
BLAST of Chy10G174210 vs. NCBI nr
Match: KAG6571494.1 (hypothetical protein SDJN03_28222, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 75.9 bits (185), Expect = 4.12e-16 Identity = 35/67 (52.24%), Postives = 50/67 (74.63%), Query Frame = 0
BLAST of Chy10G174210 vs. NCBI nr
Match: ALD47589.1 (serine proteinase inhibitor [Cucumis metulifer]) HSP 1 Score: 75.9 bits (185), Expect = 4.12e-16 Identity = 35/69 (50.72%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Chy10G174210 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 64.7 bits (156), Expect = 3.6e-11 Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of Chy10G174210 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 53.5 bits (127), Expect = 8.4e-08 Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 0
BLAST of Chy10G174210 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 47.4 bits (111), Expect = 6.0e-06 Identity = 25/67 (37.31%), Postives = 37/67 (55.22%), Query Frame = 0
BLAST of Chy10G174210 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 45.8 bits (107), Expect = 1.7e-05 Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 0
BLAST of Chy10G174210 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.3e-05 Identity = 24/63 (38.10%), Postives = 33/63 (52.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|