Chy10G173180 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATATTTGTCCTCCTGGTATTGTTTCCATTTATGATTTTACATTACTACAAGTTTTAAAACACTCTATATACATTTTTTATACAGTGTTCGTGAGTTTGAATACCCATTTGAAACATTAAGATAAAATATGAAGTTATTGTCTCTCAAAACCGATTTGGAATGAGTGGAACAACATTTATGTCTTTGATTATTGTTATGAAGACTTATTTGTACCACTTATTTCTTTTTTGCTTCTTCATAATTATGGAATACTTCTGTTTGATGATCTTTAGACTGCAGTTTTGTTTGAATATTTTTCCAATATATCTCTTTGGATATTTCATATTGTCATGATTAAATTTGGTTATTTGTTTTGGTATATAATTATGATCAGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAACGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTTGTTAATATACACGAGCTGGTTGTTGATGTTCCCAAGGTTGGTTAG ATGGCTGATATTTGTCCTCCTGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAACGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTTGTTAATATACACGAGCTGGTTGTTGATGTTCCCAAGGTTGGTTAG ATGGCTGATATTTGTCCTCCTGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAACGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTTGTTAATATACACGAGCTGGTTGTTGATGTTCCCAAGGTTGGTTAG MADICPPGKNQWPELVGVKATTAKYIIKNDNPNVENVVVLLAGSGTTEDIRCDRVWVFVNIHELVVDVPKVG* Homology
BLAST of Chy10G173180 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.4e-14 Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.2e-13 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy Swiss-Prot
Match: Q00783 (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.8e-12 Identity = 36/65 (55.38%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.4e-12 Identity = 33/65 (50.77%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.4e-12 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy TrEMBL
Match: A0A0A0KME7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 1.9e-33 Identity = 69/72 (95.83%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy TrEMBL
Match: A0A0M3SAG8 (Serine proteinase inhibitor OS=Cucumis metulifer OX=61886 PE=2 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.4e-28 Identity = 58/72 (80.56%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy TrEMBL
Match: A0A0A0KMM0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G285030 PE=3 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 1.4e-23 Identity = 53/72 (73.61%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy TrEMBL
Match: A0A6J1HFK9 (inhibitor of trypsin and hageman factor-like OS=Cucurbita moschata OX=3662 GN=LOC111463862 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 1.3e-13 Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Chy10G173180 vs. ExPASy TrEMBL
Match: A0A4Y7LG33 (Uncharacterized protein OS=Papaver somniferum OX=3469 GN=C5167_046386 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 2.2e-13 Identity = 41/72 (56.94%), Postives = 48/72 (66.67%), Query Frame = 0
BLAST of Chy10G173180 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_004718 [Cucumis sativus]) HSP 1 Score: 150 bits (379), Expect = 9.71e-46 Identity = 69/72 (95.83%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Chy10G173180 vs. NCBI nr
Match: ALD47589.1 (serine proteinase inhibitor [Cucumis metulifer]) HSP 1 Score: 134 bits (337), Expect = 2.50e-39 Identity = 58/72 (80.56%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of Chy10G173180 vs. NCBI nr
Match: KGN50838.1 (hypothetical protein Csa_004692 [Cucumis sativus]) HSP 1 Score: 117 bits (294), Expect = 9.13e-33 Identity = 53/72 (73.61%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Chy10G173180 vs. NCBI nr
Match: KAG6571494.1 (hypothetical protein SDJN03_28222, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 108 bits (270), Expect = 4.19e-29 Identity = 45/72 (62.50%), Postives = 59/72 (81.94%), Query Frame = 0
BLAST of Chy10G173180 vs. NCBI nr
Match: KAG6571499.1 (Proteinase inhibitor I-B, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 87.0 bits (214), Expect = 1.45e-20 Identity = 39/72 (54.17%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of Chy10G173180 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 68.2 bits (165), Expect = 3.2e-12 Identity = 33/66 (50.00%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of Chy10G173180 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 65.9 bits (159), Expect = 1.6e-11 Identity = 32/73 (43.84%), Postives = 47/73 (64.38%), Query Frame = 0
BLAST of Chy10G173180 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 56.2 bits (134), Expect = 1.3e-08 Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of Chy10G173180 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 56.2 bits (134), Expect = 1.3e-08 Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of Chy10G173180 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 54.3 bits (129), Expect = 4.8e-08 Identity = 28/71 (39.44%), Postives = 40/71 (56.34%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|