CcUC11G212880 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGAGATCAAAGGTATTTTGCCCCTAGAAGGGATTGAGATTTTAGATATTCGGAAAATCCCTTTTCTTAATACCCCTATTCTCCTTTCATTTGGAGCAGTCATAATGTGGGCTCATCATATCATACTTGCGGGGAAGGAAAAGCTAGCAATTTACGCTTTAGTAGCAACCGTTTCGCTAGCTCTAGTTTTCACGAATTTTCAAAGAATAGAATATTATCAAGCACCCTCCACTATTTCAAATAGTATTTATGGTCCTAGCTTTTTCTTAGCAATTGGCTTTCACGGTTTTCAATGTAACTACTTAGTATAA ATGGTAGAGATCAAAGGTATTTTGCCCCTAGAAGGGATTGAGATTTTAGATATTCGGAAAATCCCTTTTCTTAATACCCCTATTCTCCTTTCATTTGGAGCAGTCATAATGTGGGCTCATCATATCATACTTGCGGGGAAGGAAAAGCTAGCAATTTACGCTTTAGTAGCAACCGTTTCGCTAGCTCTAGTTTTCACGAATTTTCAAAGAATAGAATATTATCAAGCACCCTCCACTATTTCAAATAGTATTTATGGTCCTAGCTTTTTCTTAGCAATTGGCTTTCACGGTTTTCAATGTAACTACTTAGTATAA ATGGTAGAGATCAAAGGTATTTTGCCCCTAGAAGGGATTGAGATTTTAGATATTCGGAAAATCCCTTTTCTTAATACCCCTATTCTCCTTTCATTTGGAGCAGTCATAATGTGGGCTCATCATATCATACTTGCGGGGAAGGAAAAGCTAGCAATTTACGCTTTAGTAGCAACCGTTTCGCTAGCTCTAGTTTTCACGAATTTTCAAAGAATAGAATATTATCAAGCACCCTCCACTATTTCAAATAGTATTTATGGTCCTAGCTTTTTCTTAGCAATTGGCTTTCACGGTTTTCAATGTAACTACTTAGTATAA MVEIKGILPLEGIEILDIRKIPFLNTPILLSFGAVIMWAHHIILAGKEKLAIYALVATVSLALVFTNFQRIEYYQAPSTISNSIYGPSFFLAIGFHGFQCNYLV Homology
BLAST of CcUC11G212880 vs. NCBI nr
Match: XP_028802049.1 (uncharacterized protein LOC114757213 [Prosopis alba] >QXE45583.1 cytochrome c oxidase subunit 3 [Prosopis glandulosa]) HSP 1 Score: 147.5 bits (371), Expect = 6.3e-32 Identity = 75/97 (77.32%), Postives = 83/97 (85.57%), Query Frame = 0
BLAST of CcUC11G212880 vs. NCBI nr
Match: QWX88081.1 (cytochrome c oxidase subunit 3 [Arachis hypogaea]) HSP 1 Score: 147.5 bits (371), Expect = 6.3e-32 Identity = 75/97 (77.32%), Postives = 83/97 (85.57%), Query Frame = 0
BLAST of CcUC11G212880 vs. NCBI nr
Match: XP_025671167.2 (LOW QUALITY PROTEIN: uncharacterized protein LOC112770906 [Arachis hypogaea]) HSP 1 Score: 147.5 bits (371), Expect = 6.3e-32 Identity = 75/97 (77.32%), Postives = 83/97 (85.57%), Query Frame = 0
BLAST of CcUC11G212880 vs. NCBI nr
Match: CAD32351.1 (cytochrome oxidase subunit 3 [Convallaria keiskei]) HSP 1 Score: 145.6 bits (366), Expect = 2.4e-31 Identity = 75/97 (77.32%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. NCBI nr
Match: AHF22721.1 (cytochrome c oxidase subunit 3, partial [Fragaria mandshurica] >AHF22722.1 cytochrome c oxidase subunit 3, partial [Fragaria vesca subsp. bracteata] >AHF22725.1 cytochrome c oxidase subunit 3, partial [Fragaria vesca subsp. vesca] >AHF22727.1 cytochrome c oxidase subunit 3, partial [Fragaria vesca subsp. bracteata] >AKE33978.1 cytochrome c oxidase subunit 3, partial [Fragaria mandshurica]) HSP 1 Score: 144.8 bits (364), Expect = 4.1e-31 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy Swiss-Prot
Match: Q03227 (Cytochrome c oxidase subunit 3 OS=Vicia faba OX=3906 GN=COX3 PE=3 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 5.4e-34 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy Swiss-Prot
Match: P32808 (Cytochrome c oxidase subunit 3 OS=Helianthus annuus OX=4232 GN=COX3 PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 9.2e-34 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy Swiss-Prot
Match: P08745 (Cytochrome c oxidase subunit 3 OS=Oenothera berteroana OX=3950 GN=COX3 PE=3 SV=2) HSP 1 Score: 140.2 bits (352), Expect = 1.3e-32 Identity = 71/97 (73.20%), Postives = 81/97 (83.51%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy Swiss-Prot
Match: P14853 (Cytochrome c oxidase subunit 3 OS=Glycine max OX=3847 GN=COX3 PE=2 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.7e-32 Identity = 73/97 (75.26%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy Swiss-Prot
Match: P92514 (Cytochrome c oxidase subunit 3 OS=Arabidopsis thaliana OX=3702 GN=COX3 PE=2 SV=2) HSP 1 Score: 138.3 bits (347), Expect = 5.0e-32 Identity = 72/97 (74.23%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy TrEMBL
Match: Q5K573 (Cytochrome c oxidase subunit 3 OS=Convallaria keiskei OX=182176 GN=coiii PE=3 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 1.2e-31 Identity = 75/97 (77.32%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy TrEMBL
Match: W6JNI3 (Cytochrome c oxidase subunit 3 OS=Hevea brasiliensis OX=3981 GN=cox3 PE=3 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 2.0e-31 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy TrEMBL
Match: A0A072TI35 (Cytochrome c oxidase subunit 3 OS=Medicago truncatula OX=3880 GN=MTR_0082s0160 PE=3 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 2.0e-31 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy TrEMBL
Match: A0A126TGU6 (Cytochrome c oxidase subunit 3 OS=Medicago truncatula OX=3880 GN=cox3 PE=3 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 2.0e-31 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. ExPASy TrEMBL
Match: A0A0B4L2E6 (Cytochrome c oxidase subunit 3 (Fragment) OS=Fragaria chiloensis OX=101007 GN=cox3 PE=3 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 2.0e-31 Identity = 74/97 (76.29%), Postives = 82/97 (84.54%), Query Frame = 0
BLAST of CcUC11G212880 vs. TAIR 10
Match: AT2G07687.1 (Cytochrome c oxidase, subunit III ) HSP 1 Score: 139.4 bits (350), Expect = 1.6e-33 Identity = 72/97 (74.23%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of CcUC11G212880 vs. TAIR 10
Match: ATMG00730.1 (cytochrome c oxidase subunit 3 ) HSP 1 Score: 139.4 bits (350), Expect = 1.6e-33 Identity = 72/97 (74.23%), Postives = 80/97 (82.47%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|