CcUC06G114730 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAACCGTGAAGCTCTGCCTATTTCTCCTCCTCATCGCCGCCGCCACTATCCCTCTTGCCCTTGCCTTCCCCGACGACTGGGCCCGCGCCTACGGTGCACCCGACTACGCCTACTGGGCCTCATCAACACCGGCGGCGATGGAAGACAACCGGCGGCTACTATTCCAATATGGATTTGCTTACAAATACCCAAGAAACAAGTATTTGAGCTATGATGCACTCAGGAAGAACAATATCCCCTGCGGCCGCCGCGGCACCTCTTACTATGACTGCAGGAAGCGCCGAAAGGCCAACCCTTACCGCCGTGGCTGCACCGCCATCACCGGCTGCGCTCGATTCACTGATTAA ATGGGAACCGTGAAGCTCTGCCTATTTCTCCTCCTCATCGCCGCCGCCACTATCCCTCTTGCCCTTGCCTTCCCCGACGACTGGGCCCGCGCCTACGGTGCACCCGACTACGCCTACTGGGCCTCATCAACACCGGCGGCGATGGAAGACAACCGGCGGCTACTATTCCAATATGGATTTGCTTACAAATACCCAAGAAACAAGTATTTGAGCTATGATGCACTCAGGAAGAACAATATCCCCTGCGGCCGCCGCGGCACCTCTTACTATGACTGCAGGAAGCGCCGAAAGGCCAACCCTTACCGCCGTGGCTGCACCGCCATCACCGGCTGCGCTCGATTCACTGATTAA ATGGGAACCGTGAAGCTCTGCCTATTTCTCCTCCTCATCGCCGCCGCCACTATCCCTCTTGCCCTTGCCTTCCCCGACGACTGGGCCCGCGCCTACGGTGCACCCGACTACGCCTACTGGGCCTCATCAACACCGGCGGCGATGGAAGACAACCGGCGGCTACTATTCCAATATGGATTTGCTTACAAATACCCAAGAAACAAGTATTTGAGCTATGATGCACTCAGGAAGAACAATATCCCCTGCGGCCGCCGCGGCACCTCTTACTATGACTGCAGGAAGCGCCGAAAGGCCAACCCTTACCGCCGTGGCTGCACCGCCATCACCGGCTGCGCTCGATTCACTGATTAA MGTVKLCLFLLLIAAATIPLALAFPDDWARAYGAPDYAYWASSTPAAMEDNRRLLFQYGFAYKYPRNKYLSYDALRKNNIPCGRRGTSYYDCRKRRKANPYRRGCTAITGCARFTD Homology
BLAST of CcUC06G114730 vs. NCBI nr
Match: XP_038876152.1 (uncharacterized protein LOC120068449 [Benincasa hispida]) HSP 1 Score: 189.1 bits (479), Expect = 2.1e-44 Identity = 90/117 (76.92%), Postives = 103/117 (88.03%), Query Frame = 0
BLAST of CcUC06G114730 vs. NCBI nr
Match: XP_016902249.1 (PREDICTED: protein RALF-like 4 [Cucumis melo] >KAA0033467.1 protein RALF-like 4 [Cucumis melo var. makuwa]) HSP 1 Score: 168.7 bits (426), Expect = 3.0e-38 Identity = 84/119 (70.59%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of CcUC06G114730 vs. NCBI nr
Match: XP_004148669.1 (protein RALF-like 19 [Cucumis sativus]) HSP 1 Score: 167.2 bits (422), Expect = 8.6e-38 Identity = 83/117 (70.94%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of CcUC06G114730 vs. NCBI nr
Match: XP_008441015.1 (PREDICTED: protein RALF-like 19 [Cucumis melo] >KAA0025546.1 protein RALF-like 19 [Cucumis melo var. makuwa] >TYK25706.1 protein RALF-like 19 [Cucumis melo var. makuwa]) HSP 1 Score: 166.0 bits (419), Expect = 1.9e-37 Identity = 81/116 (69.83%), Postives = 91/116 (78.45%), Query Frame = 0
BLAST of CcUC06G114730 vs. NCBI nr
Match: XP_004150814.1 (protein RALF-like 4 [Cucumis sativus] >KGN47203.1 hypothetical protein Csa_020789 [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 4.3e-37 Identity = 82/115 (71.30%), Postives = 92/115 (80.00%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy Swiss-Prot
Match: Q6NME6 (Protein RALF-like 19 OS=Arabidopsis thaliana OX=3702 GN=RALFL19 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.8e-15 Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy Swiss-Prot
Match: Q9FZA0 (Protein RALF-like 4 OS=Arabidopsis thaliana OX=3702 GN=RALFL4 PE=1 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.7e-15 Identity = 33/47 (70.21%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy Swiss-Prot
Match: Q8L9P8 (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy Swiss-Prot
Match: Q9LUS7 (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.9e-12 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy Swiss-Prot
Match: Q945T0 (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.4e-12 Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy TrEMBL
Match: A0A5A7SVY5 (Protein RALF-like 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold111G001290 PE=3 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.4e-38 Identity = 84/119 (70.59%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy TrEMBL
Match: A0A1S4E1Z3 (protein RALF-like 4 OS=Cucumis melo OX=3656 GN=LOC107991607 PE=3 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.4e-38 Identity = 84/119 (70.59%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy TrEMBL
Match: A0A0A0KHU4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G484570 PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 4.2e-38 Identity = 83/117 (70.94%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy TrEMBL
Match: A0A5D3DPV5 (Protein RALF-like 19 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1230G00370 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 9.3e-38 Identity = 81/116 (69.83%), Postives = 91/116 (78.45%), Query Frame = 0
BLAST of CcUC06G114730 vs. ExPASy TrEMBL
Match: A0A1S3B2H7 (protein RALF-like 19 OS=Cucumis melo OX=3656 GN=LOC103485256 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 9.3e-38 Identity = 81/116 (69.83%), Postives = 91/116 (78.45%), Query Frame = 0
BLAST of CcUC06G114730 vs. TAIR 10
Match: AT2G33775.1 (ralf-like 19 ) HSP 1 Score: 82.8 bits (203), Expect = 2.0e-16 Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 0
BLAST of CcUC06G114730 vs. TAIR 10
Match: AT1G28270.1 (ralf-like 4 ) HSP 1 Score: 82.4 bits (202), Expect = 2.6e-16 Identity = 33/47 (70.21%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of CcUC06G114730 vs. TAIR 10
Match: AT4G15800.1 (ralf-like 33 ) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-13 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CcUC06G114730 vs. TAIR 10
Match: AT3G16570.1 (rapid alkalinization factor 23 ) HSP 1 Score: 72.8 bits (177), Expect = 2.1e-13 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CcUC06G114730 vs. TAIR 10
Match: AT3G05490.1 (ralf-like 22 ) HSP 1 Score: 68.9 bits (167), Expect = 3.0e-12 Identity = 27/48 (56.25%), Postives = 38/48 (79.17%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|