CcUC04G067580 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAACCTTCCTCTTCACTCATAAGTCTGTCAACGAGGGCCATCCCGACAAGCTTTGCGACCAAGTTTCCGATGCTATCCTCCACACTTGTCTTGAACAAGATTCTGAGAGCAATGTCGCTTGTGAAACCTACACCAAATCCAACATGGTCATGGTGTTTGATGAGATAACAATCAAGGCTAATGTCAACTATGAGAAAATAGTTCAAAATACTTGCGACGGAATTGGATTTATCTCTATTGATATCGGTCTTGATGCAGACGACTGCAACATGAATATTGAACAACGAATCCCAGAGCCGACTGGACACTTGACCAAGAAACCTGAGGATATTGGAGCTGGTGATCTAGGCCACATGAGTTCTCACCCATGTCCTTGCTACAAAACTTGGTGCTAA ATGATGGAAACCTTCCTCTTCACTCATAAGTCTGTCAACGAGGGCCATCCCGACAAGCTTTGCGACCAAGTTTCCGATGCTATCCTCCACACTTGTCTTGAACAAGATTCTGAGAGCAATGTCGCTTGTGAAACCTACACCAAATCCAACATGGTCATGGTGTTTGATGAGATAACAATCAAGGCTAATGTCAACTATGAGAAAATAGTTCAAAATACTTGCGACGGAATTGGATTTATCTCTATTGATATCGGTCTTGATGCAGACGACTGCAACATGAATATTGAACAACGAATCCCAGAGCCGACTGGACACTTGACCAAGAAACCTGAGGATATTGGAGCTGGTGATCTAGGCCACATGAGTTCTCACCCATGTCCTTGCTACAAAACTTGGTGCTAA ATGATGGAAACCTTCCTCTTCACTCATAAGTCTGTCAACGAGGGCCATCCCGACAAGCTTTGCGACCAAGTTTCCGATGCTATCCTCCACACTTGTCTTGAACAAGATTCTGAGAGCAATGTCGCTTGTGAAACCTACACCAAATCCAACATGGTCATGGTGTTTGATGAGATAACAATCAAGGCTAATGTCAACTATGAGAAAATAGTTCAAAATACTTGCGACGGAATTGGATTTATCTCTATTGATATCGGTCTTGATGCAGACGACTGCAACATGAATATTGAACAACGAATCCCAGAGCCGACTGGACACTTGACCAAGAAACCTGAGGATATTGGAGCTGGTGATCTAGGCCACATGAGTTCTCACCCATGTCCTTGCTACAAAACTTGGTGCTAA MMETFLFTHKSVNEGHPDKLCDQVSDAILHTCLEQDSESNVACETYTKSNMVMVFDEITIKANVNYEKIVQNTCDGIGFISIDIGLDADDCNMNIEQRIPEPTGHLTKKPEDIGAGDLGHMSSHPCPCYKTWC Homology
BLAST of CcUC04G067580 vs. NCBI nr
Match: RYR77347.1 (hypothetical protein Ahy_A01g001774 isoform C [Arachis hypogaea]) HSP 1 Score: 189.5 bits (480), Expect = 1.9e-44 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. NCBI nr
Match: QHO50060.1 (S-adenosylmethionine synthase [Arachis hypogaea]) HSP 1 Score: 189.5 bits (480), Expect = 1.9e-44 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. NCBI nr
Match: QHO39172.1 (S-adenosylmethionine synthase [Arachis hypogaea]) HSP 1 Score: 189.5 bits (480), Expect = 1.9e-44 Identity = 93/126 (73.81%), Postives = 105/126 (83.33%), Query Frame = 0
BLAST of CcUC04G067580 vs. NCBI nr
Match: RYR77345.1 (hypothetical protein Ahy_A01g001774 isoform A [Arachis hypogaea]) HSP 1 Score: 189.5 bits (480), Expect = 1.9e-44 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. NCBI nr
Match: XP_025604425.1 (S-adenosylmethionine synthase 3-like [Arachis hypogaea]) HSP 1 Score: 189.5 bits (480), Expect = 1.9e-44 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy Swiss-Prot
Match: A7PQS0 (S-adenosylmethionine synthase 1 OS=Vitis vinifera OX=29760 GN=METK1 PE=3 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 2.7e-46 Identity = 92/126 (73.02%), Postives = 104/126 (82.54%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy Swiss-Prot
Match: A9NUH8 (S-adenosylmethionine synthase 1 OS=Picea sitchensis OX=3332 GN=METK1 PE=2 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 4.6e-46 Identity = 89/126 (70.63%), Postives = 105/126 (83.33%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy Swiss-Prot
Match: P43282 (S-adenosylmethionine synthase 3 OS=Solanum lycopersicum OX=4081 GN=SAM3 PE=2 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 4.6e-46 Identity = 92/126 (73.02%), Postives = 104/126 (82.54%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy Swiss-Prot
Match: Q96553 (S-adenosylmethionine synthase 3 OS=Catharanthus roseus OX=4058 GN=SAMS3 PE=1 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 6.0e-46 Identity = 93/126 (73.81%), Postives = 103/126 (81.75%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy Swiss-Prot
Match: Q9M7K8 (S-adenosylmethionine synthase 1 OS=Nicotiana tabacum OX=4097 GN=SAMS1 PE=2 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.3e-45 Identity = 92/126 (73.02%), Postives = 103/126 (81.75%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy TrEMBL
Match: A0A445EPP0 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A01g001774 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 9.0e-45 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy TrEMBL
Match: A0A445EPF3 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A01g001774 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 9.0e-45 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy TrEMBL
Match: A0A445EPE5 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A01g001774 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 9.0e-45 Identity = 92/126 (73.02%), Postives = 106/126 (84.13%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy TrEMBL
Match: A0A1J7ID88 (S-adenosylmethionine synthase OS=Lupinus angustifolius OX=3871 GN=TanjilG_31216 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 1.2e-44 Identity = 94/126 (74.60%), Postives = 105/126 (83.33%), Query Frame = 0
BLAST of CcUC04G067580 vs. ExPASy TrEMBL
Match: A0A1S3TR49 (S-adenosylmethionine synthase OS=Vigna radiata var. radiata OX=3916 GN=LOC106757909 PE=3 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 2.0e-44 Identity = 93/126 (73.81%), Postives = 105/126 (83.33%), Query Frame = 0
BLAST of CcUC04G067580 vs. TAIR 10
Match: AT2G36880.1 (methionine adenosyltransferase 3 ) HSP 1 Score: 183.0 bits (463), Expect = 1.6e-46 Identity = 92/126 (73.02%), Postives = 102/126 (80.95%), Query Frame = 0
BLAST of CcUC04G067580 vs. TAIR 10
Match: AT2G36880.2 (methionine adenosyltransferase 3 ) HSP 1 Score: 183.0 bits (463), Expect = 1.6e-46 Identity = 92/126 (73.02%), Postives = 102/126 (80.95%), Query Frame = 0
BLAST of CcUC04G067580 vs. TAIR 10
Match: AT3G17390.1 (S-adenosylmethionine synthetase family protein ) HSP 1 Score: 180.3 bits (456), Expect = 1.1e-45 Identity = 88/126 (69.84%), Postives = 103/126 (81.75%), Query Frame = 0
BLAST of CcUC04G067580 vs. TAIR 10
Match: AT4G01850.1 (S-adenosylmethionine synthetase 2 ) HSP 1 Score: 178.3 bits (451), Expect = 4.0e-45 Identity = 87/126 (69.05%), Postives = 101/126 (80.16%), Query Frame = 0
BLAST of CcUC04G067580 vs. TAIR 10
Match: AT4G01850.2 (S-adenosylmethionine synthetase 2 ) HSP 1 Score: 178.3 bits (451), Expect = 4.0e-45 Identity = 87/126 (69.05%), Postives = 101/126 (80.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|