CcUC03G057570 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTTTAGGGATTCAATTTTGACGGTGATTGTGGTGTGTTTAGTGGGCTGGCTATGGAGACTTTTTAATTGGATTTGGTTGAGGCCAAAGAAACTTGAGAAGTGCCTGAGAGACCAAGGACTCGCCGGAAATTCTTACCGTCTTTACTCCGGCGACTTGAACGACATCGCCTCCATGATGAAACAAGCCAAATCCAAACCCATGAGCTTCTCACATGATATTGCTCCACGTGTCATCCCATCCATCCATCATACCATTCACAAATATGGCAACTTCTATGCATTTTCTTTGTAA ATGGATTTTAGGGATTCAATTTTGACGGTGATTGTGGTGTGTTTAGTGGGCTGGCTATGGAGACTTTTTAATTGGATTTGGTTGAGGCCAAAGAAACTTGAGAAGTGCCTGAGAGACCAAGGACTCGCCGGAAATTCTTACCGTCTTTACTCCGGCGACTTGAACGACATCGCCTCCATGATGAAACAAGCCAAATCCAAACCCATGAGCTTCTCACATGATATTGCTCCACGTGTCATCCCATCCATCCATCATACCATTCACAAATATGGCAACTTCTATGCATTTTCTTTGTAA ATGGATTTTAGGGATTCAATTTTGACGGTGATTGTGGTGTGTTTAGTGGGCTGGCTATGGAGACTTTTTAATTGGATTTGGTTGAGGCCAAAGAAACTTGAGAAGTGCCTGAGAGACCAAGGACTCGCCGGAAATTCTTACCGTCTTTACTCCGGCGACTTGAACGACATCGCCTCCATGATGAAACAAGCCAAATCCAAACCCATGAGCTTCTCACATGATATTGCTCCACGTGTCATCCCATCCATCCATCATACCATTCACAAATATGGCAACTTCTATGCATTTTCTTTGTAA MDFRDSILTVIVVCLVGWLWRLFNWIWLRPKKLEKCLRDQGLAGNSYRLYSGDLNDIASMMKQAKSKPMSFSHDIAPRVIPSIHHTIHKYGNFYAFSL Homology
BLAST of CcUC03G057570 vs. NCBI nr
Match: XP_038878667.1 (cytochrome P450 CYP72A219-like isoform X1 [Benincasa hispida]) HSP 1 Score: 165.6 bits (418), Expect = 2.1e-37 Identity = 76/91 (83.52%), Postives = 82/91 (90.11%), Query Frame = 0
BLAST of CcUC03G057570 vs. NCBI nr
Match: XP_038878669.1 (cytochrome P450 CYP72A219-like isoform X3 [Benincasa hispida] >XP_038878670.1 cytochrome P450 CYP72A219-like isoform X3 [Benincasa hispida]) HSP 1 Score: 165.6 bits (418), Expect = 2.1e-37 Identity = 76/91 (83.52%), Postives = 82/91 (90.11%), Query Frame = 0
BLAST of CcUC03G057570 vs. NCBI nr
Match: XP_011659939.1 (cytochrome P450 CYP72A219 [Cucumis sativus] >KAE8653395.1 hypothetical protein Csa_007101 [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 1.9e-30 Identity = 67/92 (72.83%), Postives = 76/92 (82.61%), Query Frame = 0
BLAST of CcUC03G057570 vs. NCBI nr
Match: XP_008450754.1 (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo] >TYK10171.1 cytochrome P450 CYP72A219-like protein [Cucumis melo var. makuwa]) HSP 1 Score: 142.1 bits (357), Expect = 2.5e-30 Identity = 65/92 (70.65%), Postives = 77/92 (83.70%), Query Frame = 0
BLAST of CcUC03G057570 vs. NCBI nr
Match: XP_022974803.1 (cytochrome P450 CYP72A219-like [Cucurbita maxima]) HSP 1 Score: 140.6 bits (353), Expect = 7.3e-30 Identity = 64/88 (72.73%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy Swiss-Prot
Match: H2DH21 (Cytochrome P450 CYP72A219 OS=Panax ginseng OX=4054 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 8.4e-21 Identity = 46/86 (53.49%), Postives = 62/86 (72.09%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy Swiss-Prot
Match: Q2MJ19 (Cytochrome P450 72A68 OS=Medicago truncatula OX=3880 GN=CYP72A68 PE=1 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.1e-20 Identity = 44/88 (50.00%), Postives = 60/88 (68.18%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy Swiss-Prot
Match: Q2MJ21 (Cytochrome P450 716A67 OS=Medicago truncatula OX=3880 GN=CYP72A67 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.1e-20 Identity = 47/85 (55.29%), Postives = 57/85 (67.06%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy Swiss-Prot
Match: A0A0S2IHL2 (Cytochrome P450 72A397 OS=Kalopanax septemlobus OX=228393 GN=CYP72A397 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 9.3e-20 Identity = 41/81 (50.62%), Postives = 57/81 (70.37%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy Swiss-Prot
Match: Q05047 (Secologanin synthase OS=Catharanthus roseus OX=4058 GN=CYP72A1 PE=1 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-19 Identity = 40/88 (45.45%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy TrEMBL
Match: A0A0A0M1P6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G574240 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 9.3e-31 Identity = 67/92 (72.83%), Postives = 76/92 (82.61%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy TrEMBL
Match: A0A5D3CEG3 (Cytochrome P450 CYP72A219-like protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G003160 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 1.2e-30 Identity = 65/92 (70.65%), Postives = 77/92 (83.70%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy TrEMBL
Match: A0A1S3BQL9 (cytochrome P450 CYP72A219-like OS=Cucumis melo OX=3656 GN=LOC103492242 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 1.2e-30 Identity = 65/92 (70.65%), Postives = 77/92 (83.70%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy TrEMBL
Match: A0A6J1IHE1 (cytochrome P450 CYP72A219-like OS=Cucurbita maxima OX=3661 GN=LOC111473561 PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 3.5e-30 Identity = 64/88 (72.73%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of CcUC03G057570 vs. ExPASy TrEMBL
Match: A0A6J1EYN3 (cytochrome P450 CYP72A219-like OS=Cucurbita moschata OX=3662 GN=LOC111439752 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 5.1e-29 Identity = 64/88 (72.73%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of CcUC03G057570 vs. TAIR 10
Match: AT1G17060.1 (cytochrome p450 72c1 ) HSP 1 Score: 92.8 bits (229), Expect = 1.6e-19 Identity = 38/88 (43.18%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of CcUC03G057570 vs. TAIR 10
Match: AT3G14690.1 (cytochrome P450, family 72, subfamily A, polypeptide 15 ) HSP 1 Score: 80.1 bits (196), Expect = 1.1e-15 Identity = 35/87 (40.23%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of CcUC03G057570 vs. TAIR 10
Match: AT3G14640.1 (cytochrome P450, family 72, subfamily A, polypeptide 10 ) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-15 Identity = 35/87 (40.23%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of CcUC03G057570 vs. TAIR 10
Match: AT3G14650.1 (cytochrome P450, family 72, subfamily A, polypeptide 11 ) HSP 1 Score: 77.8 bits (190), Expect = 5.4e-15 Identity = 34/74 (45.95%), Postives = 47/74 (63.51%), Query Frame = 0
BLAST of CcUC03G057570 vs. TAIR 10
Match: AT3G14610.1 (cytochrome P450, family 72, subfamily A, polypeptide 7 ) HSP 1 Score: 77.4 bits (189), Expect = 7.1e-15 Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|