CcUC03G046110 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGCGACAGTGCATCAATTTTGACCCAATCATCCCTAGTCTCCCAGCGCTCAAAGTATTTCTTCCTCCCTCTAAAAACCGCACACGGCCACAACTCGTTCGAACTGGAAACCAAATTTCGCGAAAAACATTTATTTTCTCGACGTTTACTTCGCATTTCGGAGCCATGGATGCCGTAGATTCTGTCGTTGATCCTCTCAGAGAGTTCGCCAAGGACAGCGTTCGTCTCGTTAAGAGATGTCATAAACCCGATCGCAAGGGTATGTTTCTTCCTTTCACATCATATTGCATAGATCTGATTCAATCGAGGTCTTAGATTTTTGTTTTCCCTTTCAATTTTATTTAATTCAACGTTTTGGTGGTGTAGAATTCACCAAGGTTGCCGTCCGTACCGCTATCGGATTCGTTGTGATGGGATTTGTAGGGTTCTTTGTCAAGCTAATCTTCATTCCGATCAACAACATCATCGTCGGATCTGGTTAG ATGTTGCGACAGTGCATCAATTTTGACCCAATCATCCCTAGTCTCCCAGCGCTCAAAGTATTTCTTCCTCCCTCTAAAAACCGCACACGGCCACAACTCGTTCGAACTGGAAACCAAATTTCGCGAAAAACATTTATTTTCTCGACGTTTACTTCGCATTTCGGAGCCATGGATGCCGTAGATTCTGTCGTTGATCCTCTCAGAGAGTTCGCCAAGGACAGCGTTCGTCTCGTTAAGAGATGTCATAAACCCGATCGCAAGGAATTCACCAAGGTTGCCGTCCGTACCGCTATCGGATTCGTTGTGATGGGATTTGTAGGGTTCTTTGTCAAGCTAATCTTCATTCCGATCAACAACATCATCGTCGGATCTGGTTAG ATGTTGCGACAGTGCATCAATTTTGACCCAATCATCCCTAGTCTCCCAGCGCTCAAAGTATTTCTTCCTCCCTCTAAAAACCGCACACGGCCACAACTCGTTCGAACTGGAAACCAAATTTCGCGAAAAACATTTATTTTCTCGACGTTTACTTCGCATTTCGGAGCCATGGATGCCGTAGATTCTGTCGTTGATCCTCTCAGAGAGTTCGCCAAGGACAGCGTTCGTCTCGTTAAGAGATGTCATAAACCCGATCGCAAGGAATTCACCAAGGTTGCCGTCCGTACCGCTATCGGATTCGTTGTGATGGGATTTGTAGGGTTCTTTGTCAAGCTAATCTTCATTCCGATCAACAACATCATCGTCGGATCTGGTTAG MLRQCINFDPIIPSLPALKVFLPPSKNRTRPQLVRTGNQISRKTFIFSTFTSHFGAMDAVDSVVDPLREFAKDSVRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSG Homology
BLAST of CcUC03G046110 vs. NCBI nr
Match: XP_022137357.1 (uncharacterized protein LOC111008832 isoform X1 [Momordica charantia]) HSP 1 Score: 173.7 bits (439), Expect = 9.9e-40 Identity = 94/122 (77.05%), Postives = 98/122 (80.33%), Query Frame = 0
BLAST of CcUC03G046110 vs. NCBI nr
Match: XP_022137358.1 (uncharacterized protein LOC111008832 isoform X2 [Momordica charantia]) HSP 1 Score: 173.7 bits (439), Expect = 9.9e-40 Identity = 94/122 (77.05%), Postives = 98/122 (80.33%), Query Frame = 0
BLAST of CcUC03G046110 vs. NCBI nr
Match: WP_215388869.1 (protein translocase SEC61 complex subunit gamma, partial [Staphylococcus aureus]) HSP 1 Score: 136.0 bits (341), Expect = 2.3e-28 Identity = 77/103 (74.76%), Postives = 82/103 (79.61%), Query Frame = 0
BLAST of CcUC03G046110 vs. NCBI nr
Match: XP_008439824.1 (PREDICTED: protein transport protein Sec61 subunit gamma [Cucumis melo] >XP_011652190.1 protein transport protein Sec61 subunit gamma [Cucumis sativus] >XP_022924215.1 protein transport protein Sec61 subunit gamma isoform X1 [Cucurbita moschata] >XP_022955226.1 protein transport protein Sec61 subunit gamma [Cucurbita moschata] >XP_022994502.1 protein transport protein Sec61 subunit gamma [Cucurbita maxima] >XP_023000906.1 protein transport protein Sec61 subunit gamma isoform X2 [Cucurbita maxima] >XP_023519526.1 protein transport protein Sec61 subunit gamma [Cucurbita pepo subsp. pepo] >XP_023542809.1 protein transport protein Sec61 subunit gamma [Cucurbita pepo subsp. pepo] >XP_038893830.1 protein transport protein Sec61 subunit gamma [Benincasa hispida] >KAA0055337.1 protein transport protein Sec61 subunit gamma [Cucumis melo var. makuwa] >KAG7012319.1 Protein transport protein Sec61 subunit gamma [Cucurbita argyrosperma subsp. argyrosperma] >KAE8652628.1 hypothetical protein Csa_013813 [Cucumis sativus] >TYJ99263.1 protein transport protein Sec61 subunit gamma [Cucumis melo var. makuwa]) HSP 1 Score: 135.6 bits (340), Expect = 3.0e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. NCBI nr
Match: XP_020163946.1 (protein transport protein Sec61 subunit gamma [Aegilops tauschii subsp. strangulata] >XP_037446494.1 protein transport protein Sec61 subunit gamma-like [Triticum dicoccoides] >XP_037452624.1 protein transport protein Sec61 subunit gamma-like [Triticum dicoccoides] >XP_040248138.1 protein transport protein Sec61 subunit gamma [Aegilops tauschii subsp. strangulata] >KAE8791446.1 Protein transport protein Sec61 subunit gamma [Hordeum vulgare] >KAF7089083.1 hypothetical protein CFC21_092131 [Triticum aestivum] >VAI44557.1 unnamed protein product [Triticum turgidum subsp. durum]) HSP 1 Score: 135.2 bits (339), Expect = 3.9e-28 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy Swiss-Prot
Match: P38385 (Protein transport protein Sec61 subunit gamma OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0178400 PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 1.1e-30 Identity = 68/69 (98.55%), Postives = 68/69 (98.55%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy Swiss-Prot
Match: P0DI74 (Protein transport protein Sec61 subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=SEC61G1 PE=1 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.6e-29 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy Swiss-Prot
Match: P0DI75 (Protein transport protein Sec61 subunit gamma-2 OS=Arabidopsis thaliana OX=3702 GN=SEC61G2 PE=1 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.6e-29 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy Swiss-Prot
Match: Q9SMP2 (Protein transport protein Sec61 subunit gamma-3 OS=Arabidopsis thaliana OX=3702 GN=SEC61G3 PE=1 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.2e-27 Identity = 60/68 (88.24%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy Swiss-Prot
Match: Q7Z1B8 (Protein transport protein Sec61 subunit gamma OS=Gryllotalpa orientalis OX=213494 GN=SEC61G PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.7e-22 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy TrEMBL
Match: A0A6J1CA50 (uncharacterized protein LOC111008832 isoform X2 OS=Momordica charantia OX=3673 GN=LOC111008832 PE=3 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 4.8e-40 Identity = 94/122 (77.05%), Postives = 98/122 (80.33%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy TrEMBL
Match: A0A6J1C817 (uncharacterized protein LOC111008832 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111008832 PE=3 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 4.8e-40 Identity = 94/122 (77.05%), Postives = 98/122 (80.33%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy TrEMBL
Match: A0A453NIA0 (Uncharacterized protein OS=Aegilops tauschii subsp. strangulata OX=200361 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 6.5e-29 Identity = 69/70 (98.57%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy TrEMBL
Match: A0A287TRG3 (Uncharacterized protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 6.5e-29 Identity = 69/70 (98.57%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. ExPASy TrEMBL
Match: A0A6J1JW08 (protein transport protein Sec61 subunit gamma OS=Cucurbita maxima OX=3661 GN=LOC111490205 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 1.4e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. TAIR 10
Match: AT4G24920.1 (secE/sec61-gamma protein transport protein ) HSP 1 Score: 130.2 bits (326), Expect = 1.2e-30 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. TAIR 10
Match: AT5G50460.1 (secE/sec61-gamma protein transport protein ) HSP 1 Score: 130.2 bits (326), Expect = 1.2e-30 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of CcUC03G046110 vs. TAIR 10
Match: AT3G48570.1 (secE/sec61-gamma protein transport protein ) HSP 1 Score: 124.0 bits (310), Expect = 8.4e-29 Identity = 60/68 (88.24%), Postives = 66/68 (97.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|