![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CcUC02G037610 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGGTGTTTGGGTGTTCGACAAAAGTGGCGTGGCTCGTTTAATATCCAACCCAACCAGGGAGTCCTTCGAGTGCAAGGACCCTCCCCATCCAGGCACCGCCACCGCGCCAGGGGCTCGTCCCAGAGTCCTGGTCTATCTTCCAACCAACCTAGTCATCCGGTCCTACGCCGAACTCGAGCAGTGCCTGGCCGAACTCGGGTGGAGTCGGTACCGAAATTTAGCCGAACCGGAGCTCCTCCAATTCCACCGCTCCCATGACTCGGCTCACTTGATTTCCCTCCCCAAAAGCTTCGCTAAGTTCAAGCCCATGCATATGTACGACATTGTTGTCAAAAATCGCCAGTTCTTCCAAGTTCGAGACCCTACGTCATCACTACCTTCCTAG ATGTCCGGTGTTTGGGTGTTCGACAAAAGTGGCGTGGCTCGTTTAATATCCAACCCAACCAGGGAGTCCTTCGAGTGCAAGGACCCTCCCCATCCAGGCACCGCCACCGCGCCAGGGGCTCGTCCCAGAGTCCTGGTCTATCTTCCAACCAACCTAGTCATCCGGTCCTACGCCGAACTCGAGCAGTGCCTGGCCGAACTCGGGTGGAGTCGGTACCGAAATTTAGCCGAACCGGAGCTCCTCCAATTCCACCGCTCCCATGACTCGGCTCACTTGATTTCCCTCCCCAAAAGCTTCGCTAAGTTCAAGCCCATGCATATGTACGACATTGTTGTCAAAAATCGCCAGTTCTTCCAAGTTCGAGACCCTACGTCATCACTACCTTCCTAG ATGTCCGGTGTTTGGGTGTTCGACAAAAGTGGCGTGGCTCGTTTAATATCCAACCCAACCAGGGAGTCCTTCGAGTGCAAGGACCCTCCCCATCCAGGCACCGCCACCGCGCCAGGGGCTCGTCCCAGAGTCCTGGTCTATCTTCCAACCAACCTAGTCATCCGGTCCTACGCCGAACTCGAGCAGTGCCTGGCCGAACTCGGGTGGAGTCGGTACCGAAATTTAGCCGAACCGGAGCTCCTCCAATTCCACCGCTCCCATGACTCGGCTCACTTGATTTCCCTCCCCAAAAGCTTCGCTAAGTTCAAGCCCATGCATATGTACGACATTGTTGTCAAAAATCGCCAGTTCTTCCAAGTTCGAGACCCTACGTCATCACTACCTTCCTAG MSGVWVFDKSGVARLISNPTRESFECKDPPHPGTATAPGARPRVLVYLPTNLVIRSYAELEQCLAELGWSRYRNLAEPELLQFHRSHDSAHLISLPKSFAKFKPMHMYDIVVKNRQFFQVRDPTSSLPS Homology
BLAST of CcUC02G037610 vs. NCBI nr
Match: KAG6570697.1 (Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7010544.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 245.7 bits (626), Expect = 2.1e-61 Identity = 118/129 (91.47%), Postives = 122/129 (94.57%), Query Frame = 0
BLAST of CcUC02G037610 vs. NCBI nr
Match: XP_022148408.1 (flowering-promoting factor 1-like [Momordica charantia]) HSP 1 Score: 217.6 bits (553), Expect = 6.2e-53 Identity = 110/131 (83.97%), Postives = 117/131 (89.31%), Query Frame = 0
BLAST of CcUC02G037610 vs. NCBI nr
Match: KAG6760852.1 (hypothetical protein POTOM_034035 [Populus tomentosa]) HSP 1 Score: 211.8 bits (538), Expect = 3.4e-51 Identity = 99/126 (78.57%), Postives = 110/126 (87.30%), Query Frame = 0
BLAST of CcUC02G037610 vs. NCBI nr
Match: EOY34019.1 (FPF1-like protein 1 [Theobroma cacao]) HSP 1 Score: 211.8 bits (538), Expect = 3.4e-51 Identity = 98/123 (79.67%), Postives = 112/123 (91.06%), Query Frame = 0
BLAST of CcUC02G037610 vs. NCBI nr
Match: XP_017982496.1 (PREDICTED: flowering-promoting factor 1 [Theobroma cacao]) HSP 1 Score: 211.8 bits (538), Expect = 3.4e-51 Identity = 98/123 (79.67%), Postives = 112/123 (91.06%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.4e-23 Identity = 61/122 (50.00%), Postives = 75/122 (61.48%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.8e-23 Identity = 59/122 (48.36%), Postives = 76/122 (62.30%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-22 Identity = 59/124 (47.58%), Postives = 78/124 (62.90%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy Swiss-Prot
Match: Q0E1D7 (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.5e-22 Identity = 61/123 (49.59%), Postives = 79/123 (64.23%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy Swiss-Prot
Match: Q8LR63 (Flowering-promoting factor 1-like protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0933500 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.5e-20 Identity = 58/128 (45.31%), Postives = 76/128 (59.38%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy TrEMBL
Match: A0A0A0KE84 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G190350 PE=3 SV=1) HSP 1 Score: 248.4 bits (633), Expect = 1.6e-62 Identity = 119/126 (94.44%), Postives = 122/126 (96.83%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy TrEMBL
Match: A0A6J1D405 (flowering-promoting factor 1-like OS=Momordica charantia OX=3673 GN=LOC111017063 PE=3 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 3.0e-53 Identity = 110/131 (83.97%), Postives = 117/131 (89.31%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy TrEMBL
Match: A0A061H020 (FPF1-like protein 1 OS=Theobroma cacao OX=3641 GN=TCM_041825 PE=3 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 1.6e-51 Identity = 98/123 (79.67%), Postives = 112/123 (91.06%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy TrEMBL
Match: A0A1R3HBS3 (Uncharacterized protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_20321 PE=3 SV=1) HSP 1 Score: 208.8 bits (530), Expect = 1.4e-50 Identity = 97/124 (78.23%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of CcUC02G037610 vs. ExPASy TrEMBL
Match: A0A4U5QFB7 (Uncharacterized protein OS=Populus alba OX=43335 GN=D5086_0000093850 PE=3 SV=1) HSP 1 Score: 208.8 bits (530), Expect = 1.4e-50 Identity = 98/126 (77.78%), Postives = 109/126 (86.51%), Query Frame = 0
BLAST of CcUC02G037610 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 110.2 bits (274), Expect = 1.3e-24 Identity = 59/122 (48.36%), Postives = 76/122 (62.30%), Query Frame = 0
BLAST of CcUC02G037610 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 107.5 bits (267), Expect = 8.4e-24 Identity = 59/124 (47.58%), Postives = 78/124 (62.90%), Query Frame = 0
BLAST of CcUC02G037610 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 104.4 bits (259), Expect = 7.1e-23 Identity = 58/122 (47.54%), Postives = 75/122 (61.48%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|