![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CcUC02G028180 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAATGAATAAGACATGCTTCTATTTATCGATAATATCTTCCGTTTCGTTCAAGCGGGATCTGAAGTATCAGCGTTACTGGGTAGAATGCCTTAGCCTTAGTATTGAAATGGGTTCCTTACAAGAAAGAATTACTTCTACCAAGGAAGGGTCCATAACTTCTATTCAAACTGTTTATGTACCTTTTGACGATTTAACCGATCCTGCTCCTGCCACCATATTTGCACATTTGGATGCTACTACCGTACTATCAAGAGGATTAGCTACCAAAGGTATCTATCCAACAGTAGATCCTTTAGATTCAAACTCAACTATGCTACAACCCTGA ATGTTAATGAATAAGACATGCTTCTATTTATCGATAATATCTTCCGTTTCGTTCAAGCGGGATCTGAAGTATCAGCGTTACTGGGTAGAATGCCTTAGCCTTAGTATTGAAATGGGTTCCTTACAAGAAAGAATTACTTCTACCAAGGAAGGGTCCATAACTTCTATTCAAACTGTTTATGTACCTTTTGACGATTTAACCGATCCTGCTCCTGCCACCATATTTGCACATTTGGATGCTACTACCGTACTATCAAGAGGATTAGCTACCAAAGGTATCTATCCAACAGTAGATCCTTTAGATTCAAACTCAACTATGCTACAACCCTGA ATGTTAATGAATAAGACATGCTTCTATTTATCGATAATATCTTCCGTTTCGTTCAAGCGGGATCTGAAGTATCAGCGTTACTGGGTAGAATGCCTTAGCCTTAGTATTGAAATGGGTTCCTTACAAGAAAGAATTACTTCTACCAAGGAAGGGTCCATAACTTCTATTCAAACTGTTTATGTACCTTTTGACGATTTAACCGATCCTGCTCCTGCCACCATATTTGCACATTTGGATGCTACTACCGTACTATCAAGAGGATTAGCTACCAAAGGTATCTATCCAACAGTAGATCCTTTAGATTCAAACTCAACTATGCTACAACCCTGA MLMNKTCFYLSIISSVSFKRDLKYQRYWVECLSLSIEMGSLQERITSTKEGSITSIQTVYVPFDDLTDPAPATIFAHLDATTVLSRGLATKGIYPTVDPLDSNSTMLQP Homology
BLAST of CcUC02G028180 vs. NCBI nr
Match: CAB4287509.1 (unnamed protein product [Prunus armeniaca]) HSP 1 Score: 147.1 bits (370), Expect = 8.7e-32 Identity = 77/99 (77.78%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of CcUC02G028180 vs. NCBI nr
Match: TKY69249.1 (ATP synthase subunit beta [Spatholobus suberectus]) HSP 1 Score: 142.1 bits (357), Expect = 2.8e-30 Identity = 77/97 (79.38%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of CcUC02G028180 vs. NCBI nr
Match: VDD22437.1 (unnamed protein product [Brassica rapa]) HSP 1 Score: 141.4 bits (355), Expect = 4.8e-30 Identity = 81/116 (69.83%), Postives = 85/116 (73.28%), Query Frame = 0
BLAST of CcUC02G028180 vs. NCBI nr
Match: TXG60897.1 (hypothetical protein EZV62_012260 [Acer yangbiense]) HSP 1 Score: 138.7 bits (348), Expect = 3.1e-29 Identity = 71/78 (91.03%), Postives = 72/78 (92.31%), Query Frame = 0
BLAST of CcUC02G028180 vs. NCBI nr
Match: ACF35672.1 (ATP synthase beta subunit, partial [Lasjia claudiensis]) HSP 1 Score: 137.9 bits (346), Expect = 5.3e-29 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy Swiss-Prot
Match: Q3V527 (ATP synthase subunit beta, chloroplastic OS=Acorus calamus OX=4465 GN=atpB PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.6e-31 Identity = 69/77 (89.61%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy Swiss-Prot
Match: Q70XZ6 (ATP synthase subunit beta, chloroplastic OS=Amborella trichopoda OX=13333 GN=atpB PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.6e-31 Identity = 69/77 (89.61%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy Swiss-Prot
Match: Q31794 (ATP synthase subunit beta, chloroplastic OS=Anthoceros angustus OX=48387 GN=atpB PE=2 SV=2) HSP 1 Score: 136.0 bits (341), Expect = 2.6e-31 Identity = 69/77 (89.61%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy Swiss-Prot
Match: Q9MRV8 (ATP synthase subunit beta, chloroplastic OS=Aristolochia macrophylla OX=12949 GN=atpB PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.6e-31 Identity = 69/77 (89.61%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy Swiss-Prot
Match: Q95AF8 (ATP synthase subunit beta, chloroplastic OS=Aspidistra elatior OX=39526 GN=atpB PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.6e-31 Identity = 69/77 (89.61%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy TrEMBL
Match: A0A6J5VEN7 (H(+)-transporting two-sector ATPase OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS45470 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 4.2e-32 Identity = 77/99 (77.78%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy TrEMBL
Match: A0A3P6CUH0 (H(+)-transporting two-sector ATPase OS=Brassica campestris OX=3711 GN=BRASC25T45871Z PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 2.3e-30 Identity = 81/116 (69.83%), Postives = 85/116 (73.28%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy TrEMBL
Match: A0A2N9GZW1 (H(+)-transporting two-sector ATPase OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS35679 PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 3.9e-30 Identity = 79/118 (66.95%), Postives = 87/118 (73.73%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy TrEMBL
Match: A0A5C7HUX7 (H(+)-transporting two-sector ATPase OS=Acer yangbiense OX=1000413 GN=EZV62_012260 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 1.5e-29 Identity = 71/78 (91.03%), Postives = 72/78 (92.31%), Query Frame = 0
BLAST of CcUC02G028180 vs. ExPASy TrEMBL
Match: B4YQ48 (ATP synthase subunit beta (Fragment) OS=Lasjia claudiensis OX=406997 GN=atpB PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.5e-29 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CcUC02G028180 vs. TAIR 10
Match: ATCG00480.1 (ATP synthase subunit beta ) HSP 1 Score: 133.3 bits (334), Expect = 1.2e-31 Identity = 67/77 (87.01%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of CcUC02G028180 vs. TAIR 10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 115.2 bits (287), Expect = 3.4e-26 Identity = 55/77 (71.43%), Postives = 66/77 (85.71%), Query Frame = 0
BLAST of CcUC02G028180 vs. TAIR 10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 115.2 bits (287), Expect = 3.4e-26 Identity = 55/77 (71.43%), Postives = 66/77 (85.71%), Query Frame = 0
BLAST of CcUC02G028180 vs. TAIR 10
Match: AT5G08690.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 115.2 bits (287), Expect = 3.4e-26 Identity = 55/77 (71.43%), Postives = 66/77 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|