![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CcUC02G025790 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGACATTTCCCTAAACCCAGCTTCAAACAAAACCTTCATTCGCTTCTACAAAACCTATAGTATTCCCCAAAATCCCACCAACAAACTTCCCATTTTGATCTACGCCCAAGGTGGCAGCTTCATTTCCTCCAGTGCAGCCACACTACCATTTTACGACTCGTGTTGTCATATTTTCGCTCATCTTTTAGCCCTTGTTGTGTCTTTCGATTATCGTCTCAGCCCCAAACAGCATCTCTAA ATGAAAGACATTTCCCTAAACCCAGCTTCAAACAAAACCTTCATTCGCTTCTACAAAACCTATAGTATTCCCCAAAATCCCACCAACAAACTTCCCATTTTGATCTACGCCCAAGGTGGCAGCTTCATTTCCTCCAGTGCAGCCACACTACCATTTTACGACTCGTGTTGTCATATTTTCGCTCATCTTTTAGCCCTTGTTGTGTCTTTCGATTATCGTCTCAGCCCCAAACAGCATCTCTAA ATGAAAGACATTTCCCTAAACCCAGCTTCAAACAAAACCTTCATTCGCTTCTACAAAACCTATAGTATTCCCCAAAATCCCACCAACAAACTTCCCATTTTGATCTACGCCCAAGGTGGCAGCTTCATTTCCTCCAGTGCAGCCACACTACCATTTTACGACTCGTGTTGTCATATTTTCGCTCATCTTTTAGCCCTTGTTGTGTCTTTCGATTATCGTCTCAGCCCCAAACAGCATCTCTAA MKDISLNPASNKTFIRFYKTYSIPQNPTNKLPILIYAQGGSFISSSAATLPFYDSCCHIFAHLLALVVSFDYRLSPKQHL Homology
BLAST of CcUC02G025790 vs. NCBI nr
Match: XP_023526606.1 (probable carboxylesterase 8 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 104.0 bits (258), Expect = 6.2e-19 Identity = 52/79 (65.82%), Postives = 62/79 (78.48%), Query Frame = 0
BLAST of CcUC02G025790 vs. NCBI nr
Match: XP_022924288.1 (probable carboxylesterase 8 [Cucurbita moschata]) HSP 1 Score: 102.4 bits (254), Expect = 1.8e-18 Identity = 51/79 (64.56%), Postives = 62/79 (78.48%), Query Frame = 0
BLAST of CcUC02G025790 vs. NCBI nr
Match: KAG6582576.1 (putative carboxylesterase 8, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 84.3 bits (207), Expect = 5.1e-13 Identity = 44/79 (55.70%), Postives = 57/79 (72.15%), Query Frame = 0
BLAST of CcUC02G025790 vs. NCBI nr
Match: XP_010111295.1 (probable carboxylesterase 8 [Morus notabilis] >EXC30773.1 putative carboxylesterase 8 [Morus notabilis]) HSP 1 Score: 84.0 bits (206), Expect = 6.6e-13 Identity = 42/79 (53.16%), Postives = 59/79 (74.68%), Query Frame = 0
BLAST of CcUC02G025790 vs. NCBI nr
Match: XP_024922686.1 (probable carboxylesterase 8 [Ziziphus jujuba]) HSP 1 Score: 83.6 bits (205), Expect = 8.6e-13 Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy Swiss-Prot
Match: O64640 (Probable carboxylesterase 8 OS=Arabidopsis thaliana OX=3702 GN=CXE8 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.6e-12 Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy Swiss-Prot
Match: I3PLR2 (3-O-acetylpapaveroxine carboxylesterase CXE1 OS=Papaver somniferum OX=3469 GN=CXE1 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.0e-09 Identity = 37/81 (45.68%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy Swiss-Prot
Match: A0A0A1EQ07 (3-O-acetylpapaveroxine carboxylesterase CXE2 OS=Papaver somniferum OX=3469 GN=CXE2 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.3e-07 Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy Swiss-Prot
Match: Q9LVB8 (Probable carboxylesterase 120 OS=Arabidopsis thaliana OX=3702 GN=CXE20 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.3e-05 Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy Swiss-Prot
Match: A0A2P1GIY1 (Hydrolase 4 OS=Catharanthus roseus OX=4058 GN=HL4 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.2e-04 Identity = 25/73 (34.25%), Postives = 35/73 (47.95%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy TrEMBL
Match: A0A6J1EC01 (probable carboxylesterase 8 OS=Cucurbita moschata OX=3662 GN=LOC111431817 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 8.7e-19 Identity = 51/79 (64.56%), Postives = 62/79 (78.48%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy TrEMBL
Match: W9SFQ0 (Putative carboxylesterase 8 OS=Morus notabilis OX=981085 GN=L484_027948 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 3.2e-13 Identity = 42/79 (53.16%), Postives = 59/79 (74.68%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy TrEMBL
Match: A0A6P6FMH3 (probable carboxylesterase 8 OS=Ziziphus jujuba OX=326968 GN=LOC107432635 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 4.2e-13 Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy TrEMBL
Match: A0A7N2MDV0 (Abhydrolase_3 domain-containing protein OS=Quercus lobata OX=97700 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 9.3e-13 Identity = 39/79 (49.37%), Postives = 54/79 (68.35%), Query Frame = 0
BLAST of CcUC02G025790 vs. ExPASy TrEMBL
Match: A0A6P4AD25 (probable carboxylesterase 8 OS=Ziziphus jujuba OX=326968 GN=LOC107427168 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 1.2e-12 Identity = 39/81 (48.15%), Postives = 58/81 (71.60%), Query Frame = 0
BLAST of CcUC02G025790 vs. TAIR 10
Match: AT2G45600.1 (alpha/beta-Hydrolases superfamily protein ) HSP 1 Score: 72.4 bits (176), Expect = 1.9e-13 Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 0
BLAST of CcUC02G025790 vs. TAIR 10
Match: AT5G62180.1 (carboxyesterase 20 ) HSP 1 Score: 48.1 bits (113), Expect = 3.7e-06 Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 0
BLAST of CcUC02G025790 vs. TAIR 10
Match: AT1G47480.1 (alpha/beta-Hydrolases superfamily protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.4e-05 Identity = 26/79 (32.91%), Postives = 44/79 (55.70%), Query Frame = 0
BLAST of CcUC02G025790 vs. TAIR 10
Match: AT1G68620.1 (alpha/beta-Hydrolases superfamily protein ) HSP 1 Score: 45.1 bits (105), Expect = 3.2e-05 Identity = 23/78 (29.49%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of CcUC02G025790 vs. TAIR 10
Match: AT5G06570.1 (alpha/beta-Hydrolases superfamily protein ) HSP 1 Score: 44.3 bits (103), Expect = 5.4e-05 Identity = 25/70 (35.71%), Postives = 37/70 (52.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|