![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CcUC02G025420 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGGATGAAATGGTTGTTGCTATCTGTTACAATAACGAATCATTGGTTTAACTGAATAACTAAATAAAATAGATAGACCCTTTTCTTCGTCTTAGGTCGACAGATCTTCTCCATTGAAAGATCCCCTATATGGATAATACACATCCAGTTCAACGAGCCTAATTCTAATTGTTTTGTTCCGAAGCAAACCACGGGGCAGTTCGTCCTATTCAGATATTCACGACCAAGAAACACTGGATTCTCTTTCGGGTAGGCCCTGAAAGGAGAAGGAAGGCTGGAATGCCAACAGGCCTCTATTATTGA ATGCCGGATGAAATGGTTGTTGCTATCTGTTACAATAACGAATCATTGATATTCACGACCAAGAAACACTGGATTCTCTTTCGGGTAGGCCCTGAAAGGAGAAGGAAGGCTGGAATGCCAACAGGCCTCTATTATTGA ATGCCGGATGAAATGGTTGTTGCTATCTGTTACAATAACGAATCATTGATATTCACGACCAAGAAACACTGGATTCTCTTTCGGGTAGGCCCTGAAAGGAGAAGGAAGGCTGGAATGCCAACAGGCCTCTATTATTGA MPDEMVVAICYNNESLIFTTKKHWILFRVGPERRRKAGMPTGLYY Homology
BLAST of CcUC02G025420 vs. NCBI nr
Match: RWR98153.1 (hypothetical protein CKAN_02765500 [Cinnamomum micranthum f. kanehirae]) HSP 1 Score: 73.2 bits (178), Expect = 6.6e-10 Identity = 35/55 (63.64%), Postives = 40/55 (72.73%), Query Frame = 0
BLAST of CcUC02G025420 vs. NCBI nr
Match: QIB71551.1 (Ycf15 [Siraitia grosvenorii] >QIB71570.1 Ycf15 [Siraitia grosvenorii]) HSP 1 Score: 68.6 bits (166), Expect = 1.6e-08 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. NCBI nr
Match: QTT58051.1 (hypothetical protein RF15 [Clethra fargesii] >QTT58068.1 hypothetical protein RF15 [Clethra fargesii]) HSP 1 Score: 67.8 bits (164), Expect = 2.8e-08 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CcUC02G025420 vs. NCBI nr
Match: YP_009653461.1 (Ycf15 protein [Forestiera angustifolia] >YP_009653479.1 Ycf15 protein [Forestiera angustifolia] >YP_009653637.1 Ycf15 protein [Forestiera phillyreoides] >YP_009653655.1 Ycf15 protein [Forestiera phillyreoides] >YP_009653725.1 Ycf15 protein [Forestiera segregata] >YP_009653743.1 Ycf15 protein [Forestiera segregata] >QCG71022.1 Ycf15 protein [Forestiera angustifolia] >QCG71023.1 Ycf15 protein [Forestiera angustifolia] >QCG71198.1 Ycf15 protein [Forestiera phillyreoides] >QCG71199.1 Ycf15 protein [Forestiera phillyreoides] >QCG71374.1 Ycf15 protein [Forestiera segregata]) HSP 1 Score: 67.8 bits (164), Expect = 2.8e-08 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CcUC02G025420 vs. NCBI nr
Match: YP_009676143.1 (hypothetical chloroplast RF15 [Berchemiella wilsonii] >QDE13062.1 hypothetical chloroplast RF15 [Berchemiella wilsonii]) HSP 1 Score: 67.0 bits (162), Expect = 4.7e-08 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy Swiss-Prot
Match: Q7FNR5 (Putative uncharacterized protein ycf15 OS=Atropa belladonna OX=33113 GN=ycf15-A PE=5 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-10 Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy Swiss-Prot
Match: Q3C1N3 (Putative uncharacterized protein ycf15 OS=Nicotiana sylvestris OX=4096 GN=ycf15-A PE=5 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-10 Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy Swiss-Prot
Match: Q33BV4 (Putative uncharacterized protein ycf15 OS=Nicotiana tomentosiformis OX=4098 GN=ycf15-A PE=5 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-10 Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy Swiss-Prot
Match: Q2MIE3 (Putative uncharacterized protein ycf15 OS=Solanum bulbocastanum OX=147425 GN=ycf15-A PE=5 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-10 Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy Swiss-Prot
Match: Q2VED6 (Putative uncharacterized protein ycf15 OS=Solanum tuberosum OX=4113 GN=ycf15-A PE=5 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-10 Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy TrEMBL
Match: A0A443Q561 (Uncharacterized protein OS=Cinnamomum micranthum f. kanehirae OX=337451 GN=CKAN_02765500 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 3.2e-10 Identity = 35/55 (63.64%), Postives = 40/55 (72.73%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy TrEMBL
Match: A0A6C0U8L9 (Ycf15 OS=Siraitia grosvenorii OX=190515 GN=ycf15 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 7.8e-09 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy TrEMBL
Match: A0A4D6SWX7 (Uncharacterized protein ycf15 OS=Forestiera segregata OX=126416 GN=ycf15 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy TrEMBL
Match: A0A4D6T395 (Uncharacterized protein ycf15 OS=Forestiera phillyreoides OX=2491097 GN=ycf15 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CcUC02G025420 vs. ExPASy TrEMBL
Match: A0A4D6SVT8 (Uncharacterized protein ycf15 OS=Forestiera angustifolia OX=389174 GN=ycf15 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|