CcUC01G010640 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTCCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCACCGCTCGGAAGGGCAGTCTGCTCGGCGGCTGGGAGAAGATCGACAACGTGAAGGATCCACATATTCAAGAGATCGGAATGTTCGCGGTGGCTGAGCACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTCTCCGGTATGAACTACCGCCTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAGTATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTCCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCACCGCTCGGAAGGGCAGTCTGCTCGGCGGCTGGGAGAAGATCGACAACGTGAAGGATCCACATATTCAAGAGATCGGAATGTTCGCGGTGGCTGAGCACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTCTCCGGTATGAACTACCGCCTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAGTATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTCCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCACCGCTCGGAAGGGCAGTCTGCTCGGCGGCTGGGAGAAGATCGACAACGTGAAGGATCCACATATTCAAGAGATCGGAATGTTCGCGGTGGCTGAGCACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTCTCCGGTATGAACTACCGCCTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAGTATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA MNSRSASLFLILLLPLLATARKGSLLGGWEKIDNVKDPHIQEIGMFAVAEHNKQSKGVTIEFKDVVSGEKQVVSGMNYRLVIDAKRGESIGKYQALVWEKPWENFKKLTSFKPAA Homology
BLAST of CcUC01G010640 vs. NCBI nr
Match: XP_038894857.1 (cysteine proteinase inhibitor 1 [Benincasa hispida]) HSP 1 Score: 195.7 bits (496), Expect = 2.2e-46 Identity = 97/117 (82.91%), Postives = 107/117 (91.45%), Query Frame = 0
BLAST of CcUC01G010640 vs. NCBI nr
Match: KAE8652870.1 (hypothetical protein Csa_013034 [Cucumis sativus]) HSP 1 Score: 183.7 bits (465), Expect = 8.8e-43 Identity = 90/118 (76.27%), Postives = 103/118 (87.29%), Query Frame = 0
BLAST of CcUC01G010640 vs. NCBI nr
Match: XP_011654999.2 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 183.7 bits (465), Expect = 8.8e-43 Identity = 90/118 (76.27%), Postives = 103/118 (87.29%), Query Frame = 0
BLAST of CcUC01G010640 vs. NCBI nr
Match: XP_022973098.1 (cysteine proteinase inhibitor 5-like [Cucurbita maxima] >KAG6583727.1 Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 181.4 bits (459), Expect = 4.4e-42 Identity = 93/117 (79.49%), Postives = 103/117 (88.03%), Query Frame = 0
BLAST of CcUC01G010640 vs. NCBI nr
Match: XP_022927193.1 (cysteine proteinase inhibitor 5-like [Cucurbita moschata]) HSP 1 Score: 181.0 bits (458), Expect = 5.7e-42 Identity = 92/117 (78.63%), Postives = 103/117 (88.03%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 110.2 bits (274), Expect = 1.6e-23 Identity = 56/106 (52.83%), Postives = 77/106 (72.64%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-22 Identity = 54/115 (46.96%), Postives = 75/115 (65.22%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.0e-21 Identity = 53/115 (46.09%), Postives = 74/115 (64.35%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 9.2e-19 Identity = 56/117 (47.86%), Postives = 71/117 (60.68%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.0e-18 Identity = 47/100 (47.00%), Postives = 62/100 (62.00%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy TrEMBL
Match: A0A0A0LTF5 (Cystatin-like protein OS=Cucumis sativus OX=3659 GN=Csa_1G183580 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 6.6e-44 Identity = 89/115 (77.39%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy TrEMBL
Match: A0A6J1IC35 (cysteine proteinase inhibitor 5-like OS=Cucurbita maxima OX=3661 GN=LOC111471628 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 2.1e-42 Identity = 93/117 (79.49%), Postives = 103/117 (88.03%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy TrEMBL
Match: A0A6J1EKC1 (cysteine proteinase inhibitor 5-like OS=Cucurbita moschata OX=3662 GN=LOC111434113 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.8e-42 Identity = 92/117 (78.63%), Postives = 103/117 (88.03%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy TrEMBL
Match: A0A5D3E5M5 (Cysteine proteinase inhibitor 5 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001210 PE=4 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 1.7e-39 Identity = 87/118 (73.73%), Postives = 97/118 (82.20%), Query Frame = 0
BLAST of CcUC01G010640 vs. ExPASy TrEMBL
Match: A0A1S3CJR9 (cysteine proteinase inhibitor 5 OS=Cucumis melo OX=3656 GN=LOC103501752 PE=4 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 1.7e-39 Identity = 87/118 (73.73%), Postives = 97/118 (82.20%), Query Frame = 0
BLAST of CcUC01G010640 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 110.2 bits (274), Expect = 1.2e-24 Identity = 56/106 (52.83%), Postives = 77/106 (72.64%), Query Frame = 0
BLAST of CcUC01G010640 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 73.2 bits (178), Expect = 1.6e-13 Identity = 37/96 (38.54%), Postives = 60/96 (62.50%), Query Frame = 0
BLAST of CcUC01G010640 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 72.0 bits (175), Expect = 3.5e-13 Identity = 48/116 (41.38%), Postives = 63/116 (54.31%), Query Frame = 0
BLAST of CcUC01G010640 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-11 Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 0
BLAST of CcUC01G010640 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-11 Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|